Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000160588 (click for geneview)
Transcript ID ENST00000278949(link to ensembl)
Symbol NP_938016.1
Localtion Chromosome:11:117602619:117628245:-1 band: 11q23.3
Description hypothetical protein LOC196264
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------------------------------><--------------------------
-M--Q--Q--R--G--A--A--G--S--R--G--C--A--L--F--P--L--L--G--V--L--F--F--Q--G--V--Y--I--V--F--S--L--E--
ATGCAGCAGAGAGGAGCAGCTGGAAGCCGTGGCTGCGCTCTCTTCCCTCTGCTGGGCGTCCTGTTCTTCCAGGGTGTTTATATCGTCTTTTCCTTGGAGA
::::.::: :: ::.:: .::::::::::::::::::.::: : ::: :::::::::::.:::::.::::::                            
ATGCGGCACAGTGGGGCCACTGGAAGCCGTGGCTGCGTTCTATGCCCACTGCTGGGCGTTCTGTTTTTCCAG----------------------------
-M--R--H--S--G--A--T--G--S--R--G--C--V--L--C--P--L--L--G--V--L--F--F--Q-----------------------------

----------------------------------------------------------------------------------------------------
I--R--A--D--A--H--V--R--G--Y--V--G--E--K--I--K--L--K--C--T--F--K--S--T--S--D--V--T--D--K--L--T--I--D
TTCGTGCAGATGCCCATGTCCGAGGTTATGTTGGAGAAAAGATCAAGTTGAAATGCACTTTCAAGTCAACTTCAGATGTCACTGACAAACTTACTATAGA
        :::::::::::::..::::::::::::::::. :::::::::::::::::.:::::::::: ::::  ..:::::::::::::.::.:::::
--------GATGCCCATGTCCAGGGTTATGTTGGAGAAAGTATCAAGTTGAAATGCACCTTCAAGTCAAGTTCATCCATCACTGACAAACTCACCATAGA
---------D--A--H--V--Q--G--Y--V--G--E--S--I--K--L--K--C--T--F--K--S--S--S--S--I--T--D--K--L--T--I--D

---------------------------------------><-----------------------------------------------------------
--W--T--Y--R--P--P--S--S--S--H--T--V--S--I--F--H--Y--Q--S--F--Q--Y--P--T--T--A--G--T--F--R--D--R--I-
CTGGACATATCGCCCTCCCAGCAGCAGCCACACAGTATCAATATTTCATTATCAGTCTTTCCAGTACCCAACCACAGCAGGCACATTTCGGGATCGGATT
:::::::::::: ::::::::::::::.:.::::: :::::: ::::::::::::::::::::::::::::::::: :.:::::::::::::::::.:::
CTGGACATATCGACCTCCCAGCAGCAGTCGCACAGAATCAATTTTTCATTATCAGTCTTTCCAGTACCCAACCACATCGGGCACATTTCGGGATCGAATT
--W--T--Y--R--P--P--S--S--S--R--T--E--S--I--F--H--Y--Q--S--F--Q--Y--P--T--T--S--G--T--F--R--D--R--I-

----------------------------------------------------------------------------------------------------
-S--W--V--G--N--V--Y--K--G--D--A--S--I--S--I--S--N--P--T--I--K--D--N--G--T--F--S--C--A--V--K--N--P--
TCCTGGGTTGGAAATGTATACAAAGGGGATGCATCTATAAGTATAAGCAACCCTACCATAAAGGACAATGGGACATTCAGCTGTGCTGTGAAGAATCCCC
::::::::::::.::::::::::::::::::::::.:::::.::::. ::::::::.:::::::::::::::::::::::::::::::::::::::::::
TCCTGGGTTGGAGATGTATACAAAGGGGATGCATCCATAAGCATAAAGAACCCTACTATAAAGGACAATGGGACATTCAGCTGTGCTGTGAAGAATCCCC
-S--W--V--G--D--V--Y--K--G--D--A--S--I--S--I--K--N--P--T--I--K--D--N--G--T--F--S--C--A--V--K--N--P--

--------------------------------------------------><------------------------------------------------
P--D--V--H--H--N--I--P--M--T--E--L--T--V--T--E--R--G--F--G--T--M--L--S--S--V--A--L--L--S--I--L--V--F
CAGATGTGCATCATAATATTCCCATGACAGAGCTAACAGTCACAGAAAGGGGTTTTGGCACCATGCTTTCCTCTGTGGCCCTTCTTTCCATCCTTGTCTT
::::.:::::.::::::::::: .::::::::.:::::::::::::::::   ::::::::::::::.:::::::::::.::::::::::::::.:::::
CAGACGTGCACCATAATATTCCAGTGACAGAGTTAACAGTCACAGAAAGG---TTTGGCACCATGCTCTCCTCTGTGGCTCTTCTTTCCATCCTCGTCTT
P--D--V--H--H--N--I--P--V--T--E--L--T--V--T--E--R-----F--G--T--M--L--S--S--V--A--L--L--S--I--L--V--F

----------------------------------------------------------------------------------------------------
--V--P--S--A--V--V--V--A--L--L--L--V--R--M--G--R--K--A--A--G--L--K--K--R--S--R--S--G--Y--K--K--S--S-
TGTGCCCTCAGCCGTGGTGGTTGCTCTGCTGCTGGTGAGAATGGGGAGGAAGGCTGCTGGGCTGAAGAAGAGGAGCAGGTCTGGCTATAAGAAGTCATCT
..: ::::::::.:::::::: :.:::::::::::::::::::: ::::::: :::: ::.::::::::::::::::.::::::::::::::::::::::
CATTCCCTCAGCTGTGGTGGTGGTTCTGCTGCTGGTGAGAATGGCGAGGAAGTCTGCGGGACTGAAGAAGAGGAGCAAGTCTGGCTATAAGAAGTCATCT
--I--P--S--A--V--V--V--V--L--L--L--V--R--M--A--R--K--S--A--G--L--K--K--R--S--K--S--G--Y--K--K--S--S-

----------------><--------------------------------------------------------------><------------------
-I--E--V--S--D--D--T--D--Q--E--E--E--E--A--C--M--A--R--L--C--V--R--C--A--E--C--L--D--S--D--Y--E--E--
ATTGAGGTTTCCGATGACACTGATCAGGAGGAGGAAGAGGCGTGTATGGCGAGGCTTTGTGTCCGTTGCGCTGAGTGCCTGGATTCAGACTATGAAGAGA
:::::.::::: :::                                                                                     
ATTGAAGTTTCAGAT-------------------------------------------------------------------------------------
-I--E--V--S--D--------------------------------------------------------------------------------------

------->
T--Y--*-
CATATTGA
        
--------
--------

Pig Consensus Sequence

>BGISUST0000886101
ATGCGGCACAGTGGGGCCACTGGAAGCCGTGGCTGCGTTCTATGCCCACTGCTGGGCGTTCTGTTTTTCCAG----------------------------
--------GATGCCCATGTCCAGGGTTATGTTGGAGAAAGTATCAAGTTGAAATGCACCTTCAAGTCAAGTTCATCCATCACTGACAAACTCACCATAGA
CTGGACATATCGACCTCCCAGCAGCAGTCGCACAGAATCAATTTTTCATTATCAGTCTTTCCAGTACCCAACCACATCGGGCACATTTCGGGATCGAATT
TCCTGGGTTGGAGATGTATACAAAGGGGATGCATCCATAAGCATAAAGAACCCTACTATAAAGGACAATGGGACATTCAGCTGTGCTGTGAAGAATCCCC
CAGACGTGCACCATAATATTCCAGTGACAGAGTTAACAGTCACAGAAAGG---TTTGGCACCATGCTCTCCTCTGTGGCTCTTCTTTCCATCCTCGTCTT
CATTCCCTCAGCTGTGGTGGTGGTTCTGCTGCTGGTGAGAATGGCGAGGAAGTCTGCGGGACTGAAGAAGAGGAGCAAGTCTGGCTATAAGAAGTCATCT
ATTGAAGTTTCAGAT-------------------------------------------------------------------------------------
--------


>BGISUSP0000886101
MRHSGATGSRGCVLCPLLGVLFFQ------------DAHVQGYVGESIKLKCTFKSSSSITDKLTIDWTYRPPSSSRTESIFHYQSFQYPTTSGTFRDRI
SWVGDVYKGDASISIKNPTIKDNGTFSCAVKNPPDVHHNIPVTELTVTER-FGTMLSSVALLSILVFIPSAVVVVLLLVRMARKSAGLKKRSKSGYKKSS
IEVSD-------------------------------