Sequences
EST Library Info
cbl4Blood
che1Heart - RNA from China
ese1Foetus 50 days, M. semitendinosus
eye1Foetus 50 days, Eye
jca1Joint capsule
mcp4Mammae, collostrum producing
med2Mediastinum
mga1Mammary gland - 7 days after weaning
pldo2Unavailable
pliv1Unavailable
spc3Spinal cord
spl4Spleen
tes1Testes
thg2Thyroid gland
tra3Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000108094 (click for geneview)
Transcript ID ENST00000279431(link to ensembl)
Symbol CUL2
Localtion Chromosome:10:35338814:35419576:-1 band: 10p11.21
Description Cullin-2 (CUL-2). [Source:Uniprot/SWISSPROT;Acc:Q13617]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--L--K--P--R--V--V--D--F--D--E--T--W--N--K--L--L--T--T--I--K--A--V--V--M--L--E--Y--V--E--R--A--
ATGTCTTTGAAACCAAGAGTAGTAGATTTTGATGAAACATGGAACAAACTTTTGACGACAATAAAAGCCGTGGTCATGTTGGAATACGTCGAAAGAGCAA
:::::::::::::::::::: ::.:::::::::::::: :::::::::::..: :::::::: :::::.:::::::::.::::.::::: ::.:::::.:
ATGTCTTTGAAACCAAGAGTCGTGGATTTTGATGAAACCTGGAACAAACTCCTCACGACAATCAAAGCTGTGGTCATGCTGGAGTACGTGGAGAGAGCGA
-M--S--L--K--P--R--V--V--D--F--D--E--T--W--N--K--L--L--T--T--I--K--A--V--V--M--L--E--Y--V--E--R--A--

------------------><--------------------------------------------------------------------------------
T--W--N--D--R--F--S--D--I--Y--A--L--C--V--A--Y--P--E--P--L--G--E--R--L--Y--T--E--T--K--I--F--L--E--N
CATGGAATGACCGTTTCTCAGATATCTATGCTTTATGTGTGGCCTATCCTGAACCCCTTGGAGAAAGACTTTATACAGAAACTAAGATTTTTTTGGAAAA
:::::::::::::.:::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CATGGAATGACCGCTTC---GATATCTATGCTTTATGTGTGGCCTATCCTGAACCCCTTGGAGAAAGACTTTATACAGAAACTAAGATTTTTTTGGAAAA
T--W--N--D--R--F-----D--I--Y--A--L--C--V--A--Y--P--E--P--L--G--E--R--L--Y--T--E--T--K--I--F--L--E--N

---------------------><-----------------------------------------------------------------------------
--H--V--R--H--L--H--K--R--V--L--E--S--E--E--Q--V--L--V--M--Y--H--R--Y--W--E--E--Y--S--K--G--A--D--Y-
TCATGTTCGGCATTTGCATAAGAGAGTTTTGGAGTCAGAAGAACAAGTACTTGTTATGTATCATAGGTACTGGGAAGAATACAGCAAGGGTGCAGACTAT
:::.:: :::::::::::.:::::::::.::::::: :::::.:::::.:::::::::::::::::::::::::::::.::.:::::::::::::::::.
TCACGTACGGCATTTGCACAAGAGAGTTCTGGAGTCTGAAGAGCAAGTGCTTGTTATGTATCATAGGTACTGGGAAGAGTATAGCAAGGGTGCAGACTAC
--H--V--R--H--L--H--K--R--V--L--E--S--E--E--Q--V--L--V--M--Y--H--R--Y--W--E--E--Y--S--K--G--A--D--Y-

----------------><----------------------------------------------------------------------------------
-M--D--C--L--Y--R--Y--L--N--T--Q--F--I--K--K--N--K--L--T--E--A--D--L--Q--Y--G--Y--G--G--V--D--M--N--
ATGGACTGCTTATATAGGTATCTCAACACCCAGTTTATTAAAAAGAATAAATTAACAGAAGCGGACCTTCAGTATGGCTATGGTGGTGTAGATATGAATG
:::::::::::.      :::::::::::::::::::::::::::::::::::.:::::::: ::.:::::::::::.::::::::::::::::::::::
ATGGACTGCTTG------TATCTCAACACCCAGTTTATTAAAAAGAATAAATTGACAGAAGCTGATCTTCAGTATGGTTATGGTGGTGTAGATATGAATG
-M--D--C--L--------Y--L--N--T--Q--F--I--K--K--N--K--L--T--E--A--D--L--Q--Y--G--Y--G--G--V--D--M--N--

----------------------><----------------------------------------------------------------------------
E--P--L--M--E--I--G--E--L--A--L--D--M--W--R--K--L--M--V--E--P--L--Q--A--I--L--I--R--M--L--L--R--E--I
AACCACTTATGGAAATAGGAGAGCTAGCATTGGATATGTGGAGGAAATTGATGGTTGAACCACTTCAGGCCATCCTTATCCGAATGCTGCTCCGAGAAAT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::: ::.:::::
AACCACTTATGGAAATAGGAGAGCTAGCATTGGATATGTGGAGGAAATTGATGGTTGAACCACTTCAGACCATCCTTATCCGAATGCTGCTACGGGAAAT
E--P--L--M--E--I--G--E--L--A--L--D--M--W--R--K--L--M--V--E--P--L--Q--T--I--L--I--R--M--L--L--R--E--I

-----><---------------------------------------------------------------------------------------------
--K--N--D--R--G--G--E--D--P--N--Q--K--V--I--H--G--V--I--N--S--F--V--H--V--E--Q--Y--K--K--K--F--P--L-
CAAAAATGATCGTGGTGGAGAAGACCCAAACCAGAAAGTAATCCATGGGGTTATTAACTCCTTTGTTCATGTTGAACAGTATAAGAAAAAATTCCCCTTA
::::   :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CAAA---GATCGTGGTGGAGAAGACCCAAACCAGAAAGTAATCCATGGGGTTATTAACTCCTTTGTTCATGTTGAACAGTATAAGAAAAAATTCCCCTTA
--K-----D--R--G--G--E--D--P--N--Q--K--V--I--H--G--V--I--N--S--F--V--H--V--E--Q--Y--K--K--K--F--P--L-

--><------------------------------------------------------------------------------------------------
-K--F--Y--Q--E--I--F--E--S--P--F--L--T--E--T--G--E--Y--Y--K--Q--E--A--S--N--L--L--Q--E--S--N--C--S--
AAGTTTTATCAGGAAATTTTTGAGTCTCCCTTTCTGACTGAAACAGGAGAGTATTACAAACAAGAAGCTTCAAATTTATTACAAGAATCAAACTGCTCAC
:::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AAGTTTTATCAGGAAATCTTTGAGTCTCCCTTTCTGACTGAAACAGGAGAGTATTACAAACAAGAAGCTTCAAATTTATTACAAGAATCAAACTGCTCAC
-K--F--Y--Q--E--I--F--E--S--P--F--L--T--E--T--G--E--Y--Y--K--Q--E--A--S--N--L--L--Q--E--S--N--C--S--

-------------><-------------------------------------------------------------------------------------
Q--Y--M--E--K--V--L--G--R--L--K--D--E--E--I--R--C--R--K--Y--L--H--P--S--S--Y--T--K--V--I--H--E--C--Q
AGTATATGGAAAAGGTTCTAGGTAGATTAAAAGATGAAGAAATTCGATGTCGAAAATACCTACATCCAAGTTCATATACTAAGGTGATTCATGAATGTCA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::.:::::::::::::::::
AGTATATGGAAAAGGTTCTAGGTAGATTAAAAGATGAAGAAATTCGATGTCGAAAATACTTACATCCAAGTTCATATACTAAAGTGATTCATGAATGTCA
Q--Y--M--E--K--V--L--G--R--L--K--D--E--E--I--R--C--R--K--Y--L--H--P--S--S--Y--T--K--V--I--H--E--C--Q

----------------------------------------------------------------------------><----------------------
--Q--R--M--V--A--D--H--L--Q--F--L--H--A--E--C--H--N--I--I--R--Q--E--K--K--N--D--M--A--N--M--Y--V--L-
ACAACGAATGGTAGCAGACCACTTACAGTTTTTACATGCAGAATGTCATAATATAATTCGACAAGAGAAAAAAAATGACATGGCAAATATGTACGTCTTA
.:::::::::::::::::::::::::::::.::::::::::::::::::::::: :::::::::::::::::::::   ::::::::::::::.::::::
GCAACGAATGGTAGCAGACCACTTACAGTTCTTACATGCAGAATGTCATAATATTATTCGACAAGAGAAAAAAAAT---ATGGCAAATATGTATGTCTTA
--Q--R--M--V--A--D--H--L--Q--F--L--H--A--E--C--H--N--I--I--R--Q--E--K--K--N-----M--A--N--M--Y--V--L-

----------------------------------------------------------------------------------------------------
-L--R--A--V--S--T--G--L--P--H--M--I--Q--E--L--Q--N--H--I--H--D--E--G--L--R--A--T--S--N--L--T--Q--E--
CTCCGTGCTGTGTCCACTGGTTTACCTCATATGATTCAGGAGCTGCAAAACCACATCCATGATGAGGGCCTTCGAGCAACCAGCAACCTTACTCAGGAAA
::::::::::::::::::::::::::::::::::::::::::::::::::.::.:::::::::::::::::: ::::::::::.::.:::::::::::: 
CTCCGTGCTGTGTCCACTGGTTTACCTCATATGATTCAGGAGCTGCAAAATCATATCCATGATGAGGGCCTTAGAGCAACCAGTAATCTTACTCAGGAA-
-L--R--A--V--S--T--G--L--P--H--M--I--Q--E--L--Q--N--H--I--H--D--E--G--L--R--A--T--S--N--L--T--Q--E--

-><-------------------------------------------------------------------------------------------------
N--M--P--T--L--F--V--E--S--V--L--E--V--H--G--K--F--V--Q--L--I--N--T--V--L--N--G--D--Q--H--F--M--S--A
ACATGCCAACACTATTTGTGGAGTCAGTTTTGGAAGTGCATGGTAAATTTGTTCAGCTTATCAACACTGTTTTGAATGGTGATCAGCATTTTATGAGTGC
  :::::::::::::::::::::::::::: ::::::::::::::::::::::::.:::::.::::::::::::::::::::::::::.:::::::::::
--ATGCCAACACTATTTGTGGAGTCAGTTTGGGAAGTGCATGGTAAATTTGTTCAACTTATTAACACTGTTTTGAATGGTGATCAGCACTTTATGAGTGC
---M--P--T--L--F--V--E--S--V--W--E--V--H--G--K--F--V--Q--L--I--N--T--V--L--N--G--D--Q--H--F--M--S--A

---------><----------------------------------------------------------><-----------------------------
--L--D--K--A--L--T--S--V--V--N--Y--R--E--P--K--S--V--C--K--A--P--E--L--L--A--K--Y--C--D--N--L--L--K-
GTTGGATAAGGCCCTTACGTCAGTTGTAAATTACAGAGAACCTAAGTCTGTTTGCAAAGCACCTGAACTGCTTGCTAAGTACTGTGACAACTTACTGAAG
.: :::::::::::::::.:: ::::::::::::::::::::.:::::::::::::::::::::::::::::.::::::::::::::::::::.::::::
ATGGGATAAGGCCCTTACATCTGTTGTAAATTACAGAGAACCCAAGTCTGTTTGCAAAGCACCTGAACTGCTCGCTAAGTACTGTGACAACTTGCTGAAG
--W--D--K--A--L--T--S--V--V--N--Y--R--E--P--K--S--V--C--K--A--P--E--L--L--A--K--Y--C--D--N--L--L--K-

--------------------------------------------------------------------------------------------------><
-K--S--A--K--G--M--T--E--N--E--V--E--D--R--L--T--S--F--I--T--V--F--K--Y--I--D--D--K--D--V--F--Q--K--
AAGTCAGCGAAAGGGATGACAGAGAATGAAGTGGAAGACAGGCTCACGAGCTTCATCACAGTGTTCAAATACATTGATGACAAGGACGTCTTTCAAAAGT
::.:::::.::.:::::::: ::::::::::::::.::::.::::::::::::.:::::.:: :::::::::::.:::::::::::.::.::::::::::
AAATCAGCAAAGGGGATGACTGAGAATGAAGTGGAGGACAAGCTCACGAGCTTTATCACGGTCTTCAAATACATCGATGACAAGGATGTTTTTCAAAAGT
-K--S--A--K--G--M--T--E--N--E--V--E--D--K--L--T--S--F--I--T--V--F--K--Y--I--D--D--K--D--V--F--Q--K--

-------------------------------------------------------------------------------------><-------------
F--Y--A--R--M--L--A--K--R--L--I--H--G--L--S--M--S--M--D--S--E--E--A--M--I--N--K--L--K--Q--A--C--G--Y
TCTACGCAAGAATGCTGGCAAAACGTTTAATTCATGGGTTATCCATGTCTATGGACTCTGAAGAAGCCATGATCAACAAATTAAAGCAAGCCTGTGGTTA
::::::::::::::.::::.:::::::::::::::::::::::::::::::::::.::::::::::::::::::::.:::::::::::::::::::::::
TCTACGCAAGAATGTTGGCGAAACGTTTAATTCATGGGTTATCCATGTCTATGGATTCTGAAGAAGCCATGATCAATAAATTAAAGCAAGCCTGTGGTTA
F--Y--A--R--M--L--A--K--R--L--I--H--G--L--S--M--S--M--D--S--E--E--A--M--I--N--K--L--K--Q--A--C--G--Y

----------------------------------------------------------------------------------------------------
--E--F--T--S--K--L--H--R--M--Y--T--D--M--S--V--S--A--D--L--N--N--K--F--N--N--F--I--K--N--Q--D--T--V-
TGAGTTTACCAGCAAGCTACATCGGATGTATACAGATATGAGTGTCAGCGCTGATCTCAACAATAAGTTCAACAATTTTATCAAAAACCAAGACACAGTA
:::.::::::::::::::::::::::::::::::::.:::::::::::.:: :::::::::::::::::::::::::::::::::::.::::::::::::
TGAATTTACCAGCAAGCTACATCGGATGTATACAGACATGAGTGTCAGTGCAGATCTCAACAATAAGTTCAACAATTTTATCAAAAATCAAGACACAGTA
--E--F--T--S--K--L--H--R--M--Y--T--D--M--S--V--S--A--D--L--N--N--K--F--N--N--F--I--K--N--Q--D--T--V-

--------------------------------------><------------------------------------------------------------
-I--D--L--G--I--S--F--Q--I--Y--V--L--Q--A--G--A--W--P--L--T--Q--A--P--S--S--T--F--A--I--P--Q--E--L--
ATAGATTTGGGAATTAGTTTTCAAATATATGTTCTACAGGCTGGTGCGTGGCCTCTTACTCAGGCTCCTTCATCTACGTTTGCAATTCCCCAGGAATTAG
:::::.::::: :::::::::::::::::::::::::::::::: ::.:::::::::::::::::::::::::::::::::::.::::::::::::::.:
ATAGACTTGGGCATTAGTTTTCAAATATATGTTCTACAGGCTGGGGCATGGCCTCTTACTCAGGCTCCTTCATCTACGTTTGCGATTCCCCAGGAATTGG
-I--D--L--G--I--S--F--Q--I--Y--V--L--Q--A--G--A--W--P--L--T--Q--A--P--S--S--T--F--A--I--P--Q--E--L--

----------------><-----------------------------------------------------------------><---------------
E--K--S--V--Q--M--F--E--L--F--Y--S--Q--H--F--S--G--R--K--L--T--W--L--H--Y--L--C--T--G--E--V--K--M--N
AAAAAAGTGTACAGATGTTTGAATTATTTTATAGCCAACATTTCAGTGGAAGGAAACTTACATGGTTACATTATCTGTGTACAGGTGAAGTTAAAATGAA
:::::::::::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::::::::::::: ::::::   ::::::::::::::
AAAAAAGTGTACAGATGTTTGAATTATTTTACAGCCAGCATTTCAGTGGAAGGAAACTTACATGGTTACATTATCTTTGTACA---GAAGTTAAAATGAA
E--K--S--V--Q--M--F--E--L--F--Y--S--Q--H--F--S--G--R--K--L--T--W--L--H--Y--L--C--T-----E--V--K--M--N

----------------------------------------------------------------------------------------------------
--Y--L--G--K--P--Y--V--A--M--V--T--T--Y--Q--M--A--V--L--L--A--F--N--N--S--E--T--V--S--Y--K--E--L--Q-
CTATTTGGGCAAACCATATGTAGCCATGGTTACAACATACCAAATGGCAGTTCTTCTTGCCTTTAACAACAGTGAAACTGTCAGTTATAAAGAGCTTCAG
::::::::::::::::::.:::::.:::::::::::::::::::::::.:::::::::::::::::::::::::::::.:::::.::::::::::::::.
CTATTTGGGCAAACCATACGTAGCTATGGTTACAACATACCAAATGGCGGTTCTTCTTGCCTTTAACAACAGTGAAACCGTCAGCTATAAAGAGCTTCAA
--Y--L--G--K--P--Y--V--A--M--V--T--T--Y--Q--M--A--V--L--L--A--F--N--N--S--E--T--V--S--Y--K--E--L--Q-

--------------------------------------------------------------------------------------><------------
-D--S--T--Q--M--N--E--K--E--L--T--K--T--I--K--S--L--L--D--V--K--M--I--N--H--D--S--E--K--E--D--I--D--
GACAGCACTCAGATGAATGAAAAGGAACTGACAAAAACAATCAAATCATTACTTGATGTGAAAATGATTAACCATGATTCAGAAAAGGAAGATATTGATG
:::::::::::::::::.::::::::.::::: ::::::::::::::.:::::.::::::::::::::::::::::::::::::::::::::.:::::::
GACAGCACTCAGATGAACGAAAAGGAGCTGACCAAAACAATCAAATCGTTACTCGATGTGAAAATGATTAACCATGATTCAGAAAAGGAAGACATTGATG
-D--S--T--Q--M--N--E--K--E--L--T--K--T--I--K--S--L--L--D--V--K--M--I--N--H--D--S--E--K--E--D--I--D--

----------------------------------------------------------------------------------------><----------
A--E--S--S--F--S--L--N--M--N--F--S--S--K--R--T--K--F--K--I--T--T--S--M--Q--K--D--T--P--Q--E--M--E--Q
CAGAATCTTCGTTTTCATTAAATATGAACTTTAGCAGTAAAAGAACAAAATTTAAAATTACTACATCAATGCAGAAAGACACACCACAAGAAATGGAGCA
::::.:::::.::::::::::::::::::::.:::::::::::::::::.::::::::::::::::::::::::::.::::::::::.:::::::::.::
CAGAGTCTTCATTTTCATTAAATATGAACTTCAGCAGTAAAAGAACAAAGTTTAAAATTACTACATCAATGCAGAAGGACACACCACGAGAAATGGAACA
A--E--S--S--F--S--L--N--M--N--F--S--S--K--R--T--K--F--K--I--T--T--S--M--Q--K--D--T--P--R--E--M--E--Q

----------------------------------------------------------------------------------------------------
--T--R--S--A--V--D--E--D--R--K--M--Y--L--Q--A--A--I--V--R--I--M--K--A--R--K--V--L--R--H--N--A--L--I-
GACTAGAAGTGCAGTTGATGAGGACCGGAAAATGTATCTCCAAGCTGCTATAGTTCGTATCATGAAAGCACGAAAAGTGCTTCGGCACAATGCCCTTATT
::: :::::::: ::.:::::.:::::::::::::::::::::::::::::::: :: :::::::::::.::.::::: ::::::::.::::::::::::
GACGAGAAGTGCTGTCGATGAAGACCGGAAAATGTATCTCCAAGCTGCTATAGTGCGAATCATGAAAGCGCGGAAAGTTCTTCGGCATAATGCCCTTATT
--T--R--S--A--V--D--E--D--R--K--M--Y--L--Q--A--A--I--V--R--I--M--K--A--R--K--V--L--R--H--N--A--L--I-

-----><---------------------------------------------------------------------------------------------
-Q--E--V--I--S--Q--S--R--A--R--F--N--P--S--I--S--M--I--K--K--C--I--E--V--L--I--D--K--Q--Y--I--E--R--
CAAGAGGTGATTAGCCAGTCAAGAGCTAGGTTTAATCCCAGTATCAGCATGATTAAGAAGTGTATTGAAGTTCTGATAGACAAACAATACATAGAACGCA
:::::::::::::::::.::.:::::: :::::::.::.::.::::::::::::::::::::.::.::.::.::::::::::::::.::::: ::.::::
CAAGAGGTGATTAGCCAATCGAGAGCTCGGTTTAACCCTAGCATCAGCATGATTAAGAAGTGCATCGAGGTCCTGATAGACAAACAGTACATCGAGCGCA
-Q--E--V--I--S--Q--S--R--A--R--F--N--P--S--I--S--M--I--K--K--C--I--E--V--L--I--D--K--Q--Y--I--E--R--

------------------------------------->
S--Q--A--S--A--D--E--Y--S--Y--V--A--*-
GCCAGGCGTCGGCAGATGAATACAGCTACGTCGCGTGA
::::::: :: :::::.::.::::::::::: ::::::
GCCAGGCCTCCGCAGACGAGTACAGCTACGTGGCGTGA
S--Q--A--S--A--D--E--Y--S--Y--V--A--*-

Pig Consensus Sequence

>BGISUST0000893672
ATGTCTTTGAAACCAAGAGTCGTGGATTTTGATGAAACCTGGAACAAACTCCTCACGACAATCAAAGCTGTGGTCATGCTGGAGTACGTGGAGAGAGCGA
CATGGAATGACCGCTTC---GATATCTATGCTTTATGTGTGGCCTATCCTGAACCCCTTGGAGAAAGACTTTATACAGAAACTAAGATTTTTTTGGAAAA
TCACGTACGGCATTTGCACAAGAGAGTTCTGGAGTCTGAAGAGCAAGTGCTTGTTATGTATCATAGGTACTGGGAAGAGTATAGCAAGGGTGCAGACTAC
ATGGACTGCTTG------TATCTCAACACCCAGTTTATTAAAAAGAATAAATTGACAGAAGCTGATCTTCAGTATGGTTATGGTGGTGTAGATATGAATG
AACCACTTATGGAAATAGGAGAGCTAGCATTGGATATGTGGAGGAAATTGATGGTTGAACCACTTCAGACCATCCTTATCCGAATGCTGCTACGGGAAAT
CAAA---GATCGTGGTGGAGAAGACCCAAACCAGAAAGTAATCCATGGGGTTATTAACTCCTTTGTTCATGTTGAACAGTATAAGAAAAAATTCCCCTTA
AAGTTTTATCAGGAAATCTTTGAGTCTCCCTTTCTGACTGAAACAGGAGAGTATTACAAACAAGAAGCTTCAAATTTATTACAAGAATCAAACTGCTCAC
AGTATATGGAAAAGGTTCTAGGTAGATTAAAAGATGAAGAAATTCGATGTCGAAAATACTTACATCCAAGTTCATATACTAAAGTGATTCATGAATGTCA
GCAACGAATGGTAGCAGACCACTTACAGTTCTTACATGCAGAATGTCATAATATTATTCGACAAGAGAAAAAAAAT---ATGGCAAATATGTATGTCTTA
CTCCGTGCTGTGTCCACTGGTTTACCTCATATGATTCAGGAGCTGCAAAATCATATCCATGATGAGGGCCTTAGAGCAACCAGTAATCTTACTCAGGAA-
--ATGCCAACACTATTTGTGGAGTCAGTTTGGGAAGTGCATGGTAAATTTGTTCAACTTATTAACACTGTTTTGAATGGTGATCAGCACTTTATGAGTGC
ATGGGATAAGGCCCTTACATCTGTTGTAAATTACAGAGAACCCAAGTCTGTTTGCAAAGCACCTGAACTGCTCGCTAAGTACTGTGACAACTTGCTGAAG
AAATCAGCAAAGGGGATGACTGAGAATGAAGTGGAGGACAAGCTCACGAGCTTTATCACGGTCTTCAAATACATCGATGACAAGGATGTTTTTCAAAAGT
TCTACGCAAGAATGTTGGCGAAACGTTTAATTCATGGGTTATCCATGTCTATGGATTCTGAAGAAGCCATGATCAATAAATTAAAGCAAGCCTGTGGTTA
TGAATTTACCAGCAAGCTACATCGGATGTATACAGACATGAGTGTCAGTGCAGATCTCAACAATAAGTTCAACAATTTTATCAAAAATCAAGACACAGTA
ATAGACTTGGGCATTAGTTTTCAAATATATGTTCTACAGGCTGGGGCATGGCCTCTTACTCAGGCTCCTTCATCTACGTTTGCGATTCCCCAGGAATTGG
AAAAAAGTGTACAGATGTTTGAATTATTTTACAGCCAGCATTTCAGTGGAAGGAAACTTACATGGTTACATTATCTTTGTACA---GAAGTTAAAATGAA
CTATTTGGGCAAACCATACGTAGCTATGGTTACAACATACCAAATGGCGGTTCTTCTTGCCTTTAACAACAGTGAAACCGTCAGCTATAAAGAGCTTCAA
GACAGCACTCAGATGAACGAAAAGGAGCTGACCAAAACAATCAAATCGTTACTCGATGTGAAAATGATTAACCATGATTCAGAAAAGGAAGACATTGATG
CAGAGTCTTCATTTTCATTAAATATGAACTTCAGCAGTAAAAGAACAAAGTTTAAAATTACTACATCAATGCAGAAGGACACACCACGAGAAATGGAACA
GACGAGAAGTGCTGTCGATGAAGACCGGAAAATGTATCTCCAAGCTGCTATAGTGCGAATCATGAAAGCGCGGAAAGTTCTTCGGCATAATGCCCTTATT
CAAGAGGTGATTAGCCAATCGAGAGCTCGGTTTAACCCTAGCATCAGCATGATTAAGAAGTGCATCGAGGTCCTGATAGACAAACAGTACATCGAGCGCA
GCCAGGCCTCCGCAGACGAGTACAGCTACGTGGCGTGA


>BGISUSP0000893672
MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRF-DIYALCVAYPEPLGERLYTETKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADY
MDCL--YLNTQFIKKNKLTEADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQTILIRMLLREIK-DRGGEDPNQKVIHGVINSFVHVEQYKKKFPL
KFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVLGRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKN-MANMYVL
LRAVSTGLPHMIQELQNHIHDEGLRATSNLTQE-MPTLFVESVWEVHGKFVQLINTVLNGDQHFMSAWDKALTSVVNYREPKSVCKAPELLAKYCDNLLK
KSAKGMTENEVEDKLTSFITVFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDMSVSADLNNKFNNFIKNQDTV
IDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMFELFYSQHFSGRKLTWLHYLCT-EVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQ
DSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKDTPREMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALI
QEVISQSRARFNPSISMIKKCIEVLIDKQYIERSQASADEYSYVA*