Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000151006 (click for geneview)
Transcript ID ENST00000280606(link to ensembl)
Symbol VKORC1
Localtion Chromosome:16:31002260:31008450:-1 band: 16p11.2
Description FLJ00289 protein (Fragment).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--P--L--H--C--S--L--G--D--R--T--R--P--Y--L--K--K--K--K--P--W--S--A--L--C--Y--L--P--P--T--C--G--V--
ATGCCACTGCACTGCAGCCTGGGCGACAGGACGAGACCCTACCTCAAAAAGAAAAAGCCGTGGAGTGCTCTCTGCTATCTTCCACCTACCTGTGGGGTCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--H--G--V--T--V--Y--P--C--T--Q--Q--P--G--P--C--P--S--P--S--R--A--A--A--T--E--L--N--S--W--S--V--V--L
CCCATGGTGTCACTGTCTACCCTTGCACTCAGCAGCCTGGACCTTGTCCTTCCCCTTCCAGGGCAGCAGCAACAGAACTGAATTCCTGGTCAGTGGTCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--S--L--Q--R--E--G--L--S--P--G--A--E--E--V--G--V--A--A--L--Q--L--P--R--A--Y--N--H--Y--S--Q--G--S-
GGGTTCTCTGCAGCGTGAGGGACTCAGCCCTGGGGCCGAAGAGGTGGGGGTGGCTGCCCTGCAGTTGCCCAGGGCCTATAACCACTACAGCCAGGGCTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-D--L--A--L--L--Q--L--A--H--P--T--T--H--T--P--L--C--L--P--Q--P--A--H--R--F--P--F--G--A--S--C--W--A--
GACCTGGCCCTGCTGCAGCTCGCCCACCCCACGACCCACACACCCCTCTGCCTGCCCCAGCCCGCCCATCGCTTCCCCTTTGGAGCCTCCTGCTGGGCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--G--W--D--Q--D--T--S--D--G--K--C--W--P--R--L--K--L--G--E--A--L--C--L--P--S--V--T--V--S--A--P--N--C
CTGGCTGGGATCAGGACACCAGTGATGGTAAGTGCTGGCCCAGACTGAAGCTCGGAGAGGCACTCTGCTTGCCCAGCGTCACAGTCTCAGCTCCCAACTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--G--F--Q--S--P--L--L--P--R--S--Q--T--L--A--P--A--P--S--L--S--P--A--P--G--T--L--R--N--L--R--L--R-
TCCTGGCTTCCAGTCTCCCTTGCTTCCCAGATCCCAGACTCTAGCCCCAGCCCCGTCTCTTTCACCAGCTCCTGGGACCCTACGCAATCTGCGCCTGCGT
                                                                            :::::: : ::::::::::::::.
----------------------------------------------------------------------------ACCCTAAGGAATCTGCGCCTGCGC
-----------------------------------------------------------------------------T--L--R--N--L--R--L--R-

----------------------------------------------------------------------------------------------------
-L--I--S--R--P--T--C--N--C--I--Y--N--Q--L--H--Q--R--H--L--S--N--P--A--R--P--G--M--L--C--G--G--P--Q--
CTCATCAGTCGCCCCACATGTAACTGTATCTACAACCAGCTGCACCAGCGACACCTGTCCAACCCGGCCCGGCCTGGGATGCTATGTGGGGGCCCCCAGC
:: :::::.::::::::.::::::::: :::::.:::. :::::::::::.:  ::: :::.::::::::::::.::::::::.::::::::.:::::::
CTAATCAGCCGCCCCACGTGTAACTGTCTCTACGACCGCCTGCACCAGCGGCTGCTGGCCAGCCCGGCCCGGCCCGGGATGCTGTGTGGGGGTCCCCAGC
-L--I--S--R--P--T--C--N--C--L--Y--D--R--L--H--Q--R--L--L--A--S--P--A--R--P--G--M--L--C--G--G--P--Q--

---------------------------->
P--G--V--Q--G--P--C--Q--V--*-
CTGGGGTGCAGGGCCCCTGTCAGGTCTGA
::::::::::::: :::::::::::::::
CTGGGGTGCAGGGGCCCTGTCAGGTCTGA
P--G--V--Q--G--P--C--Q--V--*-

Pig Consensus Sequence

>BGISUST0000900687
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------ACCCTAAGGAATCTGCGCCTGCGC
CTAATCAGCCGCCCCACGTGTAACTGTCTCTACGACCGCCTGCACCAGCGGCTGCTGGCCAGCCCGGCCCGGCCCGGGATGCTGTGTGGGGGTCCCCAGC
CTGGGGTGCAGGGGCCCTGTCAGGTCTGA


>BGISUSP0000900687
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------TLRNLRLR
LISRPTCNCLYDRLHQRLLASPARPGMLCGGPQPGVQGPCQV*