Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000151615 (click for geneview)
Transcript ID ENST00000281321(link to ensembl)
Symbol POU4F2
Localtion Chromosome:4:147917693:147921228:1 band: 4q31.22
Description POU domain, class 4, transcription factor 2 (Brain-specific homeobox/POU domain protein 3B) (Brn-3B). [Source:Uniprot/SWISSPROT;Acc:Q12837]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--M--M--M--S--L--N--S--K--Q--A--F--S--M--P--H--G--G--S--L--H--V--E--P--K--Y--S--A--L--H--S--T--S--
ATGATGATGATGTCCCTGAACAGCAAGCAGGCGTTTAGCATGCCGCACGGCGGCAGCCTGCACGTGGAGCCCAAGTACTCGGCACTGCACAGCACCTCGC
:::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::.::::::::.::::::
ATGATGATGATGTCCCTGAACAGCAAGCAGGCGTTCAGCATGCCGCACGGCGGCAGCCTGCACGTGGAGCCCAAGTACTCGGCATTGCACAGCGCCTCGC
-M--M--M--M--S--L--N--S--K--Q--A--F--S--M--P--H--G--G--S--L--H--V--E--P--K--Y--S--A--L--H--S--A--S--

----------------------------------------------------------------------------------------------------
P--G--S--S--A--P--I--A--P--S--A--S--S--P--S--S--S--S--N--A--G--G--G--G--G--G--G--G--G--G--G--G--G--G
CGGGCTCCTCGGCTCCCATCGCGCCCTCGGCCAGCTCCCCCAGCAGCTCGAGCAACGCTGGTGGTGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGG
: :: ::::: ::.:::.. :::::::: ::::::::.::.:.:::::::::::..:::         ::::::::.:::::..:.::::: :::::.::
CCGGATCCTCTGCCCCCGCGGCGCCCTCCGCCAGCTCTCCTAACAGCTCGAGCAGTGCT---------GGCGGCGGTGGCGGTAGTGGCGGGGGCGGTGG
P--G--S--S--A--P--A--A--P--S--A--S--S--P--N--S--S--S--S--A-----------G--G--G--G--G--S--G--G--G--G--G

---------------------------------------------------------------------------------------------><-----
--G--R--S--S--S--S--S--S--S--G--S--S--G--G--------G--G--S--E--A--M--R--R--A--C--L--P--T--P--P--S--N-
AGGCCGAAGCAGCAGCTCCAGCAGCAGTGGCAGCAGCGGCGGC------GGGGGCTCGGAGGCTATGCGGAGAGCCTGTCTTCCAACCCCACCGAGCAAT
::::::.::::::::::::::.:::::::::::::::::::::      :::::::: ::::: ::::::::::: ::::::::::::::::::      
AGGCCGGAGCAGCAGCTCCAGTAGCAGTGGCAGCAGCGGCGGCAGCGGCGGGGGCTCCGAGGCGATGCGGAGAGCGTGTCTTCCAACCCCACCG------
--G--R--S--S--S--S--S--S--S--G--S--S--G--G--S--G--G--G--S--E--A--M--R--R--A--C--L--P--T--P--P-------

----------------------------------------------------------------------------------------------------
-I--F--G--G--L--D--E--S--L--L--A--R--A--E--A--L--A--A--V--D--I--V--S--Q--S--K--S--H--H--H--H--P--P--
ATATTCGGCGGGCTGGATGAGAGTCTGCTGGCCCGCGCCGAGGCTCTGGCAGCCGTGGACATCGTCTCCCAGAGCAAGAGCCACCACCACCATCCACCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
H--H--S--P--F--K--P--D--A--T--Y--H--T--M--N--T--I--P--C--T--S--A--A--S--S--S--S--V--P--I--S--H--P--S
ACCACAGCCCCTTCAAACCGGACGCCACCTACCACACTATGAATACCATCCCGTGCACGTCGGCCGCCTCTTCTTCATCGGTGCCCATCTCGCACCCTTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--L--A--G--T--H--H--H--H--H--H--H--H--H--H--H--H--Q--P--H--Q--A--L--E--G--E--L--L--E--H--L--S--P-
CGCGTTGGCGGGCACGCACCACCACCACCACCATCACCACCACCACCACCACCAACCGCACCAGGCGCTGGAGGGCGAGCTGCTGGAGCACCTGAGTCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--L--A--L--G--A--M--A--G--P--D--G--A--V--V--S--T--P--A--H--A--P--H--M--A--T--M--N--P--M--H--Q--A--
GGGCTGGCCCTGGGCGCTATGGCGGGCCCCGACGGCGCTGTGGTGTCCACGCCGGCTCACGCGCCGCACATGGCCACCATGAACCCCATGCACCAAGCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--L--S--M--A--H--A--H--G--L--P--S--H--M--G--C--M--S--D--V--D--A--D--P--R--D--L--E--A--F--A--E--R--F
CGCTCAGCATGGCCCACGCGCACGGGCTGCCGTCGCACATGGGCTGCATGAGCGACGTGGACGCCGACCCGCGGGACCTGGAGGCATTCGCCGAGCGCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--Q--R--R--I--K--L--G--V--T--Q--A--D--V--G--S--A--L--A--N--L--K--I--P--G--V--G--S--L--S--Q--S--T-
CAAGCAGCGACGCATCAAGCTGGGGGTGACCCAGGCAGATGTGGGCTCCGCGCTGGCCAACCTCAAGATCCCCGGCGTGGGCTCGCTTAGCCAGAGCACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-I--C--R--F--E--S--L--T--L-----S--H--N--N--M--I--A--L--K--P--I--L--Q--A--W--L--E--E--A--E--K--S--H--
ATCTGCAGGTTCGAGTCCCTCACACTG---TCCCACAATAATATGATCGCGCTCAAACCCATCCTGCAGGCATGGCTCGAGGAGGCCGAGAAGTCCCACC
   ::::::::::::::::::::.::    ::.::.::.::::.::::::::::::::::::::::::.::.:::.: :::::::: :::::::::::.:
---TGCAGGTTCGAGTCCCTCACGCTTG--TCTCATAACAATACGATCGCGCTCAAACCCATCCTGCAAGCGTGGTTAGAGGAGGCGGAGAAGTCCCATC
----C--R--F--E--S--L--T--L--\--S--H--N--N--T--I--A--L--K--P--I--L--Q--A--W--L--E--E--A--E--K--S--H--

----------------------------------------------------------------------------------------------------
R--E--K--L--T--K--P--E--L--F--N--G--A--E--K--K--R--K--R--T--S--I--A--A--P--E--K--R--S--L--E--A--Y--F
GCGAGAAGCTCACCAAGCCTGAACTCTTCAATGGCGCGGAGAAGAAGCGCAAGCGCACGTCCATCGCTGCGCCAGAGAAGCGCTCGCTCGAAGCCTACTT
::::::::::::::::::: ::.::::::::.::::::::::::::::::::::::::::::::::: :::::.::::::::::::::::::::::::::
GCGAGAAGCTCACCAAGCCGGAGCTCTTCAACGGCGCGGAGAAGAAGCGCAAGCGCACGTCCATCGCGGCGCCGGAGAAGCGCTCGCTCGAAGCCTACTT
R--E--K--L--T--K--P--E--L--F--N--G--A--E--K--K--R--K--R--T--S--I--A--A--P--E--K--R--S--L--E--A--Y--F

----------------------------------------------------------------------------------------------------
--A--I--Q--P--R--P--S--S--E--K--I--A--A--I--A--E--K--L--D--L--K--K--N--V--V--R--V--W--F--C--N--Q--R-
TGCCATTCAGCCTCGGCCCTCCTCTGAAAAGATCGCCGCCATCGCGGAGAAGCTGGACCTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAACCAGAGG
.:::::.::::: :::::::::::.::.::::::::::::::::::::.::::::::::: ::::::::::::::::: :::::::::::::::: ::::
CGCCATCCAGCCGCGGCCCTCCTCCGAGAAGATCGCCGCCATCGCGGAAAAGCTGGACCTTAAGAAAAACGTGGTGCGAGTCTGGTTCTGCAACCCGAGG
--A--I--Q--P--R--P--S--S--E--K--I--A--A--I--A--E--K--L--D--L--K--K--N--V--V--R--V--W--F--C--N--P--R-

-------------------------------------->
-Q--K--Q--K--R--M--K--Y--S--A--G--I--*-
CAGAAACAGAAAAGAATGAAATATTCCGCCGGCATTTAG
::::::::::::::::::::::::::::: :::::::::
CAGAAACAGAAAAGAATGAAATATTCCGCGGGCATTTAG
-Q--K--Q--K--R--M--K--Y--S--A--G--I--*-

Pig Consensus Sequence

>BGISUST0000902883
ATGATGATGATGTCCCTGAACAGCAAGCAGGCGTTCAGCATGCCGCACGGCGGCAGCCTGCACGTGGAGCCCAAGTACTCGGCATTGCACAGCGCCTCGC
CCGGATCCTCTGCCCCCGCGGCGCCCTCCGCCAGCTCTCCTAACAGCTCGAGCAGTGCTGGCGGCGGTGGCGGTAGTGGCGGGGGCGGTGGAGGCCGGAG
CAGCAGCTCCAGTAGCAGTGGCAGCAGCGGCGGCAGCGGCGGGGGCTCCGAGGCGATGCGGAGAGCGTGTCTTCCAACC---------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------TGCAGGTTCGAG
TCCCTCACGCTttCTCATAACAATACGATCGCGCTCAAACCCATCCTGCAAGCGTGGTTAGAGGAGGCGGAGAAGTCCCATCGCGAGAAGCTCACCAAGC
CGGAGCTCTTCAACGGCGCGGAGAAGAAGCGCAAGCGCACGTCCATCGCGGCGCCGGAGAAGCGCTCGCTCGAAGCCTACTTCGCCATCCAGCCGCGGCC
CTCCTCCGAGAAGATCGCCGCCATCGCGGAAAAGCTGGACCTTAAGAAAAACGTGGTGCGAGTCTGGTTCTGCAACCCGAGGCAGAAACAGAAAAGAATG
AAATATTCCGCGGGCATTTAG


>BGISUSP0000902883
MMMMSLNSKQAFSMPHGGSLHVEPKYSALHSASPGSSAPAAPSASSPNSSSSAGGGGGSGGGGGGRSSSSSSSGSSGGSGGGSEAMRRACLPT-------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------CRFE
SLTLSHNNTIALKPILQAWLEEAEKSHREKLTKPELFNGAEKKRKRTSIAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNPRQKQKRM
KYSAGI*