Sequences
EST Library Info
eru2Foetus 50 days, regio umbilicalis
hyp3Hypothalamus
lyg1Lymphatic gland
vin2M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000152382 (click for geneview)
Transcript ID ENST00000282228(link to ensembl)
Symbol NP_444281.1
Localtion Chromosome:1:163557411:163577137:-1 band: 1q24.1
Description SPT3-associated factor 42
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<------------------------------------------------------------------------><-------------------------
-M--A--T--F--V--S--E--L--E--A--A--K--K--N--L--S--E--A--L--G--D--N--V--K--Q--Y--W--A--N--L--K--L--W--
ATGGCGACCTTTGTGAGCGAGCTGGAGGCGGCCAAGAAGAACTTAAGCGAGGCCCTGGGGGACAACGTGAAACAATACTGGGCTAACCTAAAGCTGTGGT
::::::::::::::::::::::::::::::::::::::::::::.::::::::.::::::::::::::::::   ::::::::::::.:::::.::::::
ATGGCGACCTTTGTGAGCGAGCTGGAGGCGGCCAAGAAGAACTTGAGCGAGGCTCTGGGGGACAACGTGAAA---TACTGGGCTAACTTAAAGTTGTGGT
-M--A--T--F--V--S--E--L--E--A--A--K--K--N--L--S--E--A--L--G--D--N--V--K-----Y--W--A--N--L--K--L--W--

-----------------------------------------------------------------><---------------------------------
F--K--Q--K--I--S--K--E--E--F--D--L--E--A--H--R--L--L--T--Q--D--N--V--H--S--H--N--D--F--L--L--A--I--L
TCAAGCAGAAGATCAGCAAAGAGGAGTTTGACCTTGAAGCTCATAGACTTCTCACACAGGATAATGTCCATTCTCACAATGATTTCCTCCTGGCCATTCT
::::::::::::::::::::::.::::::::::::::.:::::::::::::::::::::::::::   :::::::::::.::::::::::::::.:::::
TCAAGCAGAAGATCAGCAAAGAAGAGTTTGACCTTGAGGCTCATAGACTTCTCACACAGGATAAT---CATTCTCACAACGATTTCCTCCTGGCTATTCT
F--K--Q--K--I--S--K--E--E--F--D--L--E--A--H--R--L--L--T--Q--D--N-----H--S--H--N--D--F--L--L--A--I--L

-------------------------------><-------------------------------------------------------------------
--T--R--C--Q--I--L--V--S--T--P--D--G--A--G--S--L--P--W--P--G--G--S--A--A--K--P--G--K--P--K--G--K--K-
CACGCGTTGTCAGATTTTGGTTTCTACACCAGATGGTGCTGGATCTTTGCCTTGGCCAGGGGGTTCCGCAGCAAAACCTGGAAAACCCAAGGGAAAGAAA
:::.::::::::::::::::: :::::::::   :::::::::::::::::.::: ::::::::::.::::: :::::::::::::: :::::::::::.
CACACGTTGTCAGATTTTGGTGTCTACACCA---GGTGCTGGATCTTTGCCCTGGACAGGGGGTTCTGCAGCCAAACCTGGAAAACCAAAGGGAAAGAAG
--T--R--C--Q--I--L--V--S--T--P-----G--A--G--S--L--P--W--T--G--G--S--A--A--K--P--G--K--P--K--G--K--K-

-----------------------------><---------------------------------------------------------------------
-K--L--S--S--V--R--Q--K--F--D--H--R--F--Q--P--Q--N--P--L--S--G--A--Q--Q--F--V--A--K--D--P--Q--D--D--
AAGCTTTCTTCTGTTCGTCAGAAATTTGATCATAGATTCCAGCCTCAAAATCCTCTCTCAGGAGCCCAGCAATTTGTGGCAAAGGATCCCCAAGATGATG
:::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::.:::::::::::.::::::::::::::::::::::::::::
AAGCTTTCTTCTGTTCGTCAGAAATTTGATCATAGATTCCAGCCTCAAAATCCCCTCTCGGGAGCCCAGCAGTTTGTGGCAAAGGATCCCCAAGATGATG
-K--L--S--S--V--R--Q--K--F--D--H--R--F--Q--P--Q--N--P--L--S--G--A--Q--Q--F--V--A--K--D--P--Q--D--D--

----------------------------------------------------------------------------------------------------
D--D--L--K--L--C--S--H--T--M--M--L--P--T--R--G--Q--L--E--G--R--M--I--V--T--A--Y--E--H--G--L--D--N--V
ACGACTTGAAACTTTGTTCCCACACAATGATGCTTCCCACTCGAGGCCAGCTTGAAGGGAGAATGATAGTGACTGCTTATGAGCATGGGCTGGACAATGT
:.::::::::::::::.::::::::::::::::::::::::::.::.::::::::::::::::::::::::::::::::.:::::.:::::::::::.::
ATGACTTGAAACTTTGCTCCCACACAATGATGCTTCCCACTCGGGGTCAGCTTGAAGGGAGAATGATAGTGACTGCTTACGAGCACGGGCTGGACAACGT
D--D--L--K--L--C--S--H--T--M--M--L--P--T--R--G--Q--L--E--G--R--M--I--V--T--A--Y--E--H--G--L--D--N--V

---------------------------------------><-----------------------------------------------------------
--T--E--E--A--V--S--A--V--V--Y--A--V--E--N--H--L--K--D--I--L--T--S--V--V--S--R--R--K--A--Y--R--L--R-
CACCGAGGAGGCTGTTTCAGCTGTTGTCTATGCTGTGGAGAATCACCTTAAAGATATACTGACGTCAGTTGTGTCAAGAAGGAAAGCTTATCGGTTACGA
:::::::::::::::.:::::::: :::::::: ::::::::::::::::::::::::.::::.::::::::::::::::::::::::::.::.::::: 
CACCGAGGAGGCTGTCTCAGCTGTGGTCTATGCGGTGGAGAATCACCTTAAAGATATATTGACATCAGTTGTGTCAAGAAGGAAAGCTTACCGATTACGT
--T--E--E--A--V--S--A--V--V--Y--A--V--E--N--H--L--K--D--I--L--T--S--V--V--S--R--R--K--A--Y--R--L--R-

-------------------------------------------------------------------------------------------><-------
-D--G--H--F--K--Y--A--F--G--S--N--V--T--P--Q--P--Y--L--K--N--S--V--V--A--Y--N--N--L--I--E--S--P--P--
GATGGTCATTTTAAATATGCCTTTGGCAGTAACGTGACCCCGCAGCCATACCTGAAGAATAGTGTAGTAGCTTACAACAACTTAATAGAAAGCCCTCCAG
::::::::::::::::::::::: ::.:::::.::::::::.::::::::::::::::::::::::::::: :::::::::::.::::::   :::::::
GATGGTCATTTTAAATATGCCTTGGGTAGTAATGTGACCCCACAGCCATACCTGAAGAATAGTGTAGTAGCATACAACAACTTGATAGAA---CCTCCAG
-D--G--H--F--K--Y--A--L--G--S--N--V--T--P--Q--P--Y--L--K--N--S--V--V--A--Y--N--N--L--I--E-----P--P--

----------------------------------------------------------------------------------------------------
A--F--T--A--P--C--A--G--Q--N--P--A--S--H--P--P--P--D--D--A--E--Q--Q--A--A--L--L--L--A--C--S--G--D--T
CTTTTACTGCTCCCTGTGCTGGTCAGAATCCAGCTTCTCACCCACCCCCTGATGATGCTGAGCAGCAGGCTGCACTCCTGCTGGCATGCTCCGGAGACAC
:.::: :::::::.:::::::::::::::::::: ::.:::::.:::::::::::::::::::::::::::::.::::::::.::.::::: ::.:::::
CCTTTTCTGCTCCTTGTGCTGGTCAGAATCCAGCGTCCCACCCGCCCCCTGATGATGCTGAGCAGCAGGCTGCGCTCCTGCTAGCGTGCTCGGGGGACAC
A--F--S--A--P--C--A--G--Q--N--P--A--S--H--P--P--P--D--D--A--E--Q--Q--A--A--L--L--L--A--C--S--G--D--T

------------------------------------------------------><--------------------------------------------
--L--P--A--S--L--P--P--V--N--M--Y--D--L--F--E--A--L--Q--V--H--R--E--V--I--P--T--H--T--V--Y--A--L--N-
TCTACCTGCATCTTTGCCTCCGGTGAACATGTACGATCTTTTTGAAGCTTTGCAGGTGCACAGGGAAGTCATCCCTACACATACTGTCTATGCTCTTAAC
 ::.:: ::::::::::::::.::::::::::::::.::.:::::::::::::::::.::::::::::::::.::::::::.::::: ::::: ::.:::
GCTGCCGGCATCTTTGCCTCCAGTGAACATGTACGACCTCTTTGAAGCTTTGCAGGTACACAGGGAAGTCATTCCTACACACACTGTATATGCGCTCAAC
--L--P--A--S--L--P--P--V--N--M--Y--D--L--F--E--A--L--Q--V--H--R--E--V--I--P--T--H--T--V--Y--A--L--N-

----------------------------------------------------------------------------------------------------
-I--E--R--I--I--T--K--L--W--H--P--N--H--E--E--L--Q--Q--D--K--V--H--R--Q--R--L--A--A--K--E--G--L--L--
ATTGAAAGGATCATCACGAAACTCTGGCATCCAAATCATGAAGAGCTGCAGCAAGACAAAGTTCACCGCCAGCGCTTGGCAGCCAAGGAGGGGCTTTTGC
::::::::::::::::.:::.::::::::.::::::::.:::::::::::::::::::::::.::::::::::::.:::::::::::::::: :::::::
ATTGAAAGGATCATCATGAAGCTCTGGCACCCAAATCACGAAGAGCTGCAGCAAGACAAAGTCCACCGCCAGCGCCTGGCAGCCAAGGAGGGTCTTTTGC
-I--E--R--I--I--M--K--L--W--H--P--N--H--E--E--L--Q--Q--D--K--V--H--R--Q--R--L--A--A--K--E--G--L--L--

------->
L--C--*-
TGTGCTAA
: ::::.:
TCTGCTGA
L--C--*-

Pig Consensus Sequence

>BGISUST0000889094
ATGGCGACCTTTGTGAGCGAGCTGGAGGCGGCCAAGAAGAACTTGAGCGAGGCTCTGGGGGACAACGTGAAA---TACTGGGCTAACTTAAAGTTGTGGT
TCAAGCAGAAGATCAGCAAAGAAGAGTTTGACCTTGAGGCTCATAGACTTCTCACACAGGATAAT---CATTCTCACAACGATTTCCTCCTGGCTATTCT
CACACGTTGTCAGATTTTGGTGTCTACACCA---GGTGCTGGATCTTTGCCCTGGACAGGGGGTTCTGCAGCCAAACCTGGAAAACCAAAGGGAAAGAAG
AAGCTTTCTTCTGTTCGTCAGAAATTTGATCATAGATTCCAGCCTCAAAATCCCCTCTCGGGAGCCCAGCAGTTTGTGGCAAAGGATCCCCAAGATGATG
ATGACTTGAAACTTTGCTCCCACACAATGATGCTTCCCACTCGGGGTCAGCTTGAAGGGAGAATGATAGTGACTGCTTACGAGCACGGGCTGGACAACGT
CACCGAGGAGGCTGTCTCAGCTGTGGTCTATGCGGTGGAGAATCACCTTAAAGATATATTGACATCAGTTGTGTCAAGAAGGAAAGCTTACCGATTACGT
GATGGTCATTTTAAATATGCCTTGGGTAGTAATGTGACCCCACAGCCATACCTGAAGAATAGTGTAGTAGCATACAACAACTTGATAGAA---CCTCCAG
CCTTTTCTGCTCCTTGTGCTGGTCAGAATCCAGCGTCCCACCCGCCCCCTGATGATGCTGAGCAGCAGGCTGCGCTCCTGCTAGCGTGCTCGGGGGACAC
GCTGCCGGCATCTTTGCCTCCAGTGAACATGTACGACCTCTTTGAAGCTTTGCAGGTACACAGGGAAGTCATTCCTACACACACTGTATATGCGCTCAAC
ATTGAAAGGATCATCATGAAGCTCTGGCACCCAAATCACGAAGAGCTGCAGCAAGACAAAGTCCACCGCCAGCGCCTGGCAGCCAAGGAGGGTCTTTTGC
TCTGCTGA


>BGISUSP0000889094
MATFVSELEAAKKNLSEALGDNVK-YWANLKLWFKQKISKEEFDLEAHRLLTQDN-HSHNDFLLAILTRCQILVSTP-GAGSLPWTGGSAAKPGKPKGKK
KLSSVRQKFDHRFQPQNPLSGAQQFVAKDPQDDDDLKLCSHTMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVENHLKDILTSVVSRRKAYRLR
DGHFKYALGSNVTPQPYLKNSVVAYNNLIE-PPAFSAPCAGQNPASHPPPDDAEQQAALLLACSGDTLPASLPPVNMYDLFEALQVHREVIPTHTVYALN
IERIIMKLWHPNHEELQQDKVHRQRLAAKEGLLLC*