Sequences
EST Library Info
cje2Jejunum - RNA from China
fat2Fatt
nlu1Newborn 115 days, lung
spl4Spleen
Clusters
Oligos
SNPs

Gene ID ENSG00000152492 (click for geneview)
Transcript ID ENST00000282358(link to ensembl)
Symbol NP_848018.1
Localtion Chromosome:3:192529576:192592666:1 band: 3q28
Description Ymer protein long isoform
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------------------><--------------------------------------------------
-M--A--E--V--S--I--D--Q--S--K--L--P--G--V--K--E--V--C--R--D--F--A--V--L--E--D--H--T--L--A--H--S--L--
ATGGCTGAAGTCAGCATCGACCAGTCCAAGCTGCCTGGAGTCAAGGAAGTATGCCGAGATTTTGCTGTCCTGGAGGACCACACCCTGGCTCACAGCCTGC
::: ::::::::::::::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::.::::::::::
ATGTCTGAAGTCAGCATCGACCAGTCCAAGCTGCCTGGAGTCAAGGAA---TGCCGAGATTTTGCTGTCCTGGAGGACCACACCCTGGCCCACAGCCTGC
-M--S--E--V--S--I--D--Q--S--K--L--P--G--V--K--E-----C--R--D--F--A--V--L--E--D--H--T--L--A--H--S--L--

-----------><---------------------------------------------------------------------------------------
Q--E--Q--E--I--E--H--H--L--A--S--N--V--Q--R--N--R--L--V--Q--H--D--L--Q--V--A--K--Q--L--Q--E--E--D--L
AGGAACAAGAGATTGAGCATCATTTGGCATCGAACGTTCAGCGGAACCGTTTGGTCCAGCATGATCTCCAGGTGGCTAAGCAGCTCCAAGAGGAAGATCT
::::::::      ::::::::.:::::::::::.:::::::::::::::::::::::::::::::::::::::::.::::::::.::.::.::::::.:
AGGAACAA------GAGCATCACTTGGCATCGAATGTTCAGCGGAACCGTTTGGTCCAGCATGATCTCCAGGTGGCCAAGCAGCTTCAGGAAGAAGATTT
Q--E--Q--------E--H--H--L--A--S--N--V--Q--R--N--R--L--V--Q--H--D--L--Q--V--A--K--Q--L--Q--E--E--D--L

--------------------------------------><------------------------------------------------------------
--K--A--Q--A--Q--L--Q--K--R--Y--K--D--L--E--Q--Q--D--C--E--I--A--Q--E--I--Q--E--K--L--A--I--E--A--E-
GAAAGCGCAGGCCCAGCTCCAGAAGCGCTACAAAGACCTTGAACAACAAGACTGTGAAATTGCTCAGGAAATTCAGGAGAAGCTGGCTATTGAGGCAGAG
:::::: :::::.::::: ::::::::::::::::::   :::::::::::::::::.::::::::.::.::.::::::::::::.::::.:::::::::
GAAAGCTCAGGCTCAGCTGCAGAAGCGCTACAAAGAC---GAACAACAAGACTGTGAGATTGCTCAAGAGATCCAGGAGAAGCTGACTATCGAGGCAGAG
--K--A--Q--A--Q--L--Q--K--R--Y--K--D-----E--Q--Q--D--C--E--I--A--Q--E--I--Q--E--K--L--T--I--E--A--E-

-----------------------------><---------------------------------------------------------------------
-R--R--R--I--Q--E--K--K--D--E--D--I--A--R--L--L--Q--E--K--E--L--Q--E--E--K--K--R--K--K--H--F--P--E--
AGACGACGCATTCAGGAGAAGAAGGATGAGGACATAGCTCGCCTTTTGCAAGAAAAGGAGTTACAGGAAGAGAAAAAGAGAAAGAAACACTTTCCAGAGT
::::::::::::::::::::::::::.:::::::::::::: ::.:::::.::::::::::::::::::::::::::: ::::::::::::::::.::: 
AGACGACGCATTCAGGAGAAGAAGGACGAGGACATAGCTCGACTCTTGCAGGAAAAGGAGTTACAGGAAGAGAAAAAGCGAAAGAAACACTTTCCGGAGG
-R--R--R--I--Q--E--K--K--D--E--D--I--A--R--L--L--Q--E--K--E--L--Q--E--E--K--K--R--K--K--H--F--P--E--

-----------------------------------------------><---------------------------------------------------
F--P--A--T--R--A--Y--A--D--S--Y--Y--Y--E--D--G--D--Q--P--G--S--R--R--A--R--E--L--G--S--G--F--S--R--P
TCCCTGCAACCCGTGCTTATGCAGATAGTTACTATTATGAAGATGGAGACCAACCAGGGTCAAGGAGGGCCAGGGAATTGGGTTCTGGATTCTCAAGACC
.:.::: :.:: .::::::::  ::.:::::::::::::::::::::                                                     
CCTCTGGAGCCAATGCTTATGGTGACAGTTACTATTATGAAGATGGA-----------------------------------------------------
A--S--G--A--N--A--Y--G--D--S--Y--Y--Y--E--D--G------------------------------------------------------

----------------------------------------------------------------------------------------------------
--C--R--L--Q--R--D--G--K--T--V--K--H--K--K--E--K--P--E--H--P--L--E--N--L--E--E--P--E--Q--H--C--S--S-
TTGTAGACTCCAAAGAGATGGAAAGACTGTGAAGCACAAGAAAGAGAAACCAGAACATCCACTGGAGAACTTGGAAGAGCCAGAACAACATTGTTCATCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--R--S--L--S--S--S--S--S--G--K--G--R--D--N--P--H--I--N--N--E--Q--H--E--R--K--R--S--T--Q--E--R--P--
AAGAGATCCCTGTCATCCTCTAGCTCGGGCAAAGGGAGGGACAATCCCCATATTAACAATGAGCAGCATGAAAGGAAACGGTCCACTCAGGAGAGGCCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--R--P--L--L--P--T--I--S--G--E--V--F--L--S--T--E--C--D--D--W--E--T--K--I--N--H--Q--T--R--N--W--E--K
GGAGACCTCTGCTTCCCACGATCAGTGGTGAAGTGTTTCTGAGCACTGAATGTGATGACTGGGAGACTAAGATTAACCATCAGACTCGAAATTGGGAAAA
  :::::::. ::::::: ::::::::::::.::::::::::::::.::::  ::::::::::::.:: :   ::.:::::..:::::.:.: ::::.::
--AGACCTCCTCTTCCCAGGATCAGTGGTGAGGTGTTTCTGAGCACCGAATCGGATGACTGGGAGGCTCACCATAGCCATCGAACTCGGAGTGGGGAGAA
---R--P--P--L--P--R--I--S--G--E--V--F--L--S--T--E--S--D--D--W--E--A--H--H--S--H--R--T--R--S--G--E--K

----------------------------------------------------------------------------------------------------
--Q--S--R--H--Q--D--R--L--S--P--K--S--S--Q--K--A--G--L--H--C--K--E--V--V--Y--G--R--D--H--G--Q--G--E-
ACAGTCTCGACACCAAGATCGACTTTCACCCAAGTCCTCACAAAAAGCAGGGCTTCACTGCAAGGAAGTTGTATATGGGAGGGACCATGGGCAAGGTGAG
:::  : ::.::::::::.:::::::: ::::::::::::::.::::::::::::: :::::::::::.::::::::::::::::::::::::::: : :
ACATGCACGGCACCAAGACCGACTTTCTCCCAAGTCCTCACAGAAAGCAGGGCTTCCCTGCAAGGAAGCTGTATATGGGAGGGACCATGGGCAAGGGGTG
--H--A--R--H--Q--D--R--L--S--P--K--S--S--Q--K--A--G--L--P--C--K--E--A--V--Y--G--R--D--H--G--Q--G--V-

---------------------------------------------------------------------------><-----------------------
-H--R--K--R--R--H--R--P--R--T--P--P--F--S--E--S--E--E--Q--L--H--L--H--D--A--G--M--K--P--R--V--M--K--
CACAGAAAAAGGAGACACAGGCCCAGGACTCCTCCATTCTCAGAGAGTGAGGAGCAGCTCCACCTCCATGACGCAGGAATGAAGCCAAGAGTGATGAAAG
::::::.::::::.::::::::: :::::::  :: :::::::::::::::::::.:::::: :::::::::      .::::.:: :::::.:::::::
CACAGAGAAAGGAAACACAGGCCAAGGACTCGGCCCTTCTCAGAGAGTGAGGAGCGGCTCCAGCTCCATGAC------GTGAAACCCAGAGTAATGAAAG
-H--R--E--R--K--H--R--P--R--T--R--P--F--S--E--S--E--E--R--L--Q--L--H--D--------V--K--P--R--V--M--K--

-------------------------------------------------------------------------------------------><-------
E--A--V--S--T--P--S--R--M--A--H--R--D--Q--E--W--Y--D--A--E--I--A--R--K--L--Q--E--E--E--L--L--A--T--Q
AAGCTGTATCTACTCCATCACGAATGGCCCACAGGGATCAGGAATGGTATGATGCTGAAATTGCCAGAAAACTGCAAGAAGAAGAACTTTTGGCTACCCA
: .:::: :::::::: ::::::.::.::::::::::::::::::::: .:::::::::::::::::::::::::::::::::::: :::::        
ACACTGTCTCTACTCCCTCACGAGTGACCCACAGGGATCAGGAATGGTCCGATGCTGAAATTGCCAGAAAACTGCAAGAAGAAGAAATTTTG--------
D--T--V--S--T--P--S--R--V--T--H--R--D--Q--E--W--S--D--A--E--I--A--R--K--L--Q--E--E--E--I--L---------

------------------------------------><--------------------------------------------------------------
--V--D--M--R--A--A--Q--V--A--Q--D--E--E--I--A--R--L--L--M--A--E--E--K--K--A--Y--K--K--A--K--E--R--E-
GGTGGACATGAGAGCCGCTCAAGTAGCTCAAGATGAAGAAATCGCTCGACTTCTAATGGCTGAAGAAAAGAAAGCTTACAAAAAAGCCAAGGAGCGGGAG
                                     ::::::::: :::::::::::::::: :::::::::::::::::.:::::::.::::::::::
-------------------------------------GAAATCGCTAGACTTCTAATGGCTGACGAAAAGAAAGCTTACAAGAAAGCCAGGGAGCGGGAG
--------------------------------------E--I--A--R--L--L--M--A--D--E--K--K--A--Y--K--K--A--R--E--R--E-

-----------------------------------------><---------------------------------------------------------
-K--S--S--L--D--K--R--K--Q--D--P--E--W--K--P--K--T--A--K--A--A--N--S--K--S--K--E--S--D--E--P--H--H--
AAATCATCTTTGGACAAAAGAAAGCAAGACCCCGAGTGGAAGCCAAAAACAGCTAAAGCAGCAAATTCCAAGTCAAAAGAGAGTGATGAACCTCACCATT
:::::::::::::::::::::::::: :::::.::::::::::: ::::: :::::: ::::: :.:: :::::::::::.::::::::::::::::.::
AAATCATCTTTGGACAAAAGAAAGCATGACCCTGAGTGGAAGCCCAAAACCGCTAAATCAGCACACTCAAAGTCAAAAGAAAGTGATGAACCTCACCGTT
-K--S--S--L--D--K--R--K--H--D--P--E--W--K--P--K--T--A--K--S--A--H--S--K--S--K--E--S--D--E--P--H--R--

---------------------><-----------------------------------------------------------------------------
S--K--N--E--R--P--A--R--P--P--P--P--I--M--T--D--G--E--D--A--D--Y--T--H--F--T--N--Q--Q--S--S--T--R--H
CTAAGAATGAAAGGCCAGCACGGCCACCACCACCTATCATGACAGATGGTGAAGATGCGGATTACACTCATTTTACAAACCAGCAGAGTTCCACACGGCA
:::::::::: :::::::::   :::::::::::::.::::::::::: :::.::: .::::::::::::::::::::::::::: :.::::::::: ::
CTAAGAATGACAGGCCAGCA---CCACCACCACCTACCATGACAGATGCTGAGGATTTGGATTACACTCATTTTACAAACCAGCATAATTCCACACGTCA
S--K--N--D--R--P--A-----P--P--P--P--T--M--T--D--A--E--D--L--D--Y--T--H--F--T--N--Q--H--N--S--T--R--H

----------------------------><------------------>
--F--S--K--S--E--S--S--H--K--G--F--H--Y--K--H--*-
TTTCTCAAAATCAGAGTCCTCTCATAAAGGTTTTCATTACAAACATTAA
:::::::::. :::::::.:::::::::                     
TTTCTCAAAGGCAGAGTCTTCTCATAAA---------------------
--F--S--K--A--E--S--S--H--K----------------------

Pig Consensus Sequence

>BGISUST0000896243
ATGTCTGAAGTCAGCATCGACCAGTCCAAGCTGCCTGGAGTCAAGGAA---TGCCGAGATTTTGCTGTCCTGGAGGACCACACCCTGGCCCACAGCCTGC
AGGAACAA------GAGCATCACTTGGCATCGAATGTTCAGCGGAACCGTTTGGTCCAGCATGATCTCCAGGTGGCCAAGCAGCTTCAGGAAGAAGATTT
GAAAGCTCAGGCTCAGCTGCAGAAGCGCTACAAAGAC---GAACAACAAGACTGTGAGATTGCTCAAGAGATCCAGGAGAAGCTGACTATCGAGGCAGAG
AGACGACGCATTCAGGAGAAGAAGGACGAGGACATAGCTCGACTCTTGCAGGAAAAGGAGTTACAGGAAGAGAAAAAGCGAAAGAAACACTTTCCGGAGG
CCTCTGGAGCCAATGCTTATGGTGACAGTTACTATTATGAAGATGGA-----------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--AGACCTCCTCTTCCCAGGATCAGTGGTGAGGTGTTTCTGAGCACCGAATCGGATGACTGGGAGGCTCACCATAGCCATCGAACTCGGAGTGGGGAGAA
ACATGCACGGCACCAAGACCGACTTTCTCCCAAGTCCTCACAGAAAGCAGGGCTTCCCTGCAAGGAAGCTGTATATGGGAGGGACCATGGGCAAGGGGTG
CACAGAGAAAGGAAACACAGGCCAAGGACTCGGCCCTTCTCAGAGAGTGAGGAGCGGCTCCAGCTCCATGAC------GTGAAACCCAGAGTAATGAAAG
ACACTGTCTCTACTCCCTCACGAGTGACCCACAGGGATCAGGAATGGTCCGATGCTGAAATTGCCAGAAAACTGCAAGAAGAAGAAATTTTG--------
-------------------------------------GAAATCGCTAGACTTCTAATGGCTGACGAAAAGAAAGCTTACAAGAAAGCCAGGGAGCGGGAG
AAATCATCTTTGGACAAAAGAAAGCATGACCCTGAGTGGAAGCCCAAAACCGCTAAATCAGCACACTCAAAGTCAAAAGAAAGTGATGAACCTCACCGTT
CTAAGAATGACAGGCCAGCA---CCACCACCACCTACCATGACAGATGCTGAGGATTTGGATTACACTCATTTTACAAACCAGCATAATTCCACACGTCA
TTTCTCAAAGGCAGAGTCTTCTCATAAA---------------------


>BGISUSP0000896243
MSEVSIDQSKLPGVKE-CRDFAVLEDHTLAHSLQEQ--EHHLASNVQRNRLVQHDLQVAKQLQEEDLKAQAQLQKRYKD-EQQDCEIAQEIQEKLTIEAE
RRRIQEKKDEDIARLLQEKELQEEKKRKKHFPEASGANAYGDSYYYEDG---------------------------------------------------
----------------------------------RPPLPRISGEVFLSTESDDWEAHHSHRTRSGEKHARHQDRLSPKSSQKAGLPCKEAVYGRDHGQGV
HRERKHRPRTRPFSESEERLQLHD--VKPRVMKDTVSTPSRVTHRDQEWSDAEIARKLQEEEIL---------------EIARLLMADEKKAYKKARERE
KSSLDKRKHDPEWKPKTAKSAHSKSKESDEPHRSKNDRPA-PPPPTMTDAEDLDYTHFTNQHNSTRHFSKAESSHK-------