Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000154080 (click for geneview)
Transcript ID ENST00000284224(link to ensembl)
Symbol CHST9
Localtion Chromosome:18:22749660:23019279:-1 band: 18q11.2
Description Carbohydrate sulfotransferase 9 (EC 2.8.2.-) (N-acetylgalactosamine-4- O-sulfotransferase 2) (GalNAc-4-O-sulfotransferase 2) (GALNAc-4-ST2). [Source:Uniprot/SWISSPROT;Acc:Q7L1S5]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--Q--P--S--E--M--V--M--N--P--K--Q--V--F--L--S--V--L--I--F--G--V--A--G--L--L--L--F--M--Y--L--Q--V--
ATGCAGCCATCTGAAATGGTCATGAACCCCAAACAAGTCTTCCTCTCTGTGCTGATATTTGGAGTAGCTGGGCTACTCCTCTTCATGTATTTGCAAGTCT
   :::::.::::: .:::::::::::::::::::.::::::.:::: ::::::::::::::.:.::: :::::.:::::::::::::::::::::::::
---CAGCCGTCTGATGTGGTCATGAACCCCAAACAGGTCTTCTTCTCAGTGCTGATATTTGGGGCAGCAGGGCTGCTCCTCTTCATGTATTTGCAAGTCT
----Q--P--S--D--V--V--M--N--P--K--Q--V--F--F--S--V--L--I--F--G--A--A--G--L--L--L--F--M--Y--L--Q--V--

--------------------><-------------------------------------><---------------------------------------
W--I--E--E--Q--H--T--G--R--V--E--K--R--R--E--Q--K--V--T--S--G--W--G--P--V--K--Y--L--R--P--V--P--R--I
GGATTGAAGAACAACATACAGGGAGAGTGGAGAAGAGAAGAGAACAAAAAGTAACTTCAGGATGGGGACCAGTGAAGTACTTGCGGCCTGTACCCAGAAT
::::::::::::::::.:::                                                                                
GGATTGAAGAACAACACACA--------------------------------------------------------------------------------
W--I--E--E--Q--H--T---------------------------------------------------------------------------------

-><------------------------------------><-----------------------------------------------------------
--M--S--T--E--K--I--Q--E--H--I--T--N--Q--N--P--K--F--H--M--P--E--D--V--R--E--K--K--E--N--L--L--L--N-
CATGAGTACAGAAAAAATCCAGGAACATATCACCAACCAGAACCCCAAGTTTCACATGCCTGAGGATGTACGAGAAAAAAAGGAAAATCTTCTACTCAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--E--R--S--T--R--L--L--T--K--T--S--H--S--Q--G--G--D--Q--A--L--S--K--S--T--G--S--P--T--E--K--L--I--
TCTGAGAGATCTACTAGGCTCTTAACAAAGACCAGTCATTCACAAGGAGGGGATCAAGCTTTAAGTAAGTCCACAGGGTCACCAACAGAGAAGTTGATTG
                                                         :::::..:::.: :::::::::: ::.:.:.   :::::::::
---------------------------------------------------------GCTTTGGGTAGGACCACAGGGTCCCCGATAATTCAGTTGATTG
----------------------------------------------------------A--L--G--R--T--T--G--S--P--I--I--Q--L--I--

----------------------------------------------------------------------------------------------------
E--K--R--Q--G--A--K--T--V--F--N--K--F--S--N--M--N--W--P--V--D--I--H--P--L--N--K--S--L--V--K--D--N--K
AAAAACGTCAAGGAGCTAAGACTGTTTTTAACAAGTTCAGCAACATGAATTGGCCAGTGGACATTCACCCTTTAAACAAAAGTTTAGTCAAAGATAATAA
::::::..: .:...:::::::: ::::.:. :::::::::.: :::::::::::..::::: .::.:::::::::::::::.:::::::::::::..::
AAAAACACCTGGAGACTAAGACTTTTTTCAGGAAGTTCAGCGAAATGAATTGGCCGATGGACCCTCGCCCTTTAAACAAAAGCTTAGTCAAAGATAGCAA
E--K--H--L--E--T--K--T--F--F--R--K--F--S--E--M--N--W--P--M--D--P--R--P--L--N--K--S--L--V--K--D--S--K

----------------------------------------------------------------------------------------------------
--W--K--K--T--E--E--T--Q--E--K--R--R--S--F--L--Q--E--F--C--K--K--Y--G--G--V--S--H--H--Q--S--H--L--F-
ATGGAAGAAAACTGAGGAGACCCAAGAGAAACGAAGGTCTTTCCTTCAGGAGTTTTGCAAGAAATACGGTGGGGTGAGTCATCATCAGTCACATCTTTTT
::::::...::.::: :  ::.:::::.::::: :::::::::::::::::.::::::::::::::.:::::.:::::::..:  ::::: :::::::::
ATGGAAAGGAATTGATGCTACTCAAGAAAAACGCAGGTCTTTCCTTCAGGAATTTTGCAAGAAATATGGTGGAGTGAGTCGCCCGCAGTCCCATCTTTTT
--W--K--G--I--D--A--T--Q--E--K--R--R--S--F--L--Q--E--F--C--K--K--Y--G--G--V--S--R--P--Q--S--H--L--F-

----------------------------------------------------------------------------------------------------
-H--T--V--S--R--I--Y--V--E--D--K--H--K--I--L--Y--C--E--V--P--K--A--G--C--S--N--W--K--R--I--L--M--V--
CATACAGTATCCAGAATCTATGTAGAAGATAAACACAAAATCTTATATTGTGAGGTACCTAAGGCTGGCTGTTCCAATTGGAAAAGAATTCTGATGGTAC
::.:..::::::::.::::::::::::::::::::::::::::::::.:::::.::::: :::::.::.::::::::.:::::.::::::::::::::::
CACATGGTATCCAGGATCTATGTAGAAGATAAACACAAAATCTTATACTGTGAAGTACCAAAGGCCGGTTGTTCCAACTGGAAGAGAATTCTGATGGTAC
-H--M--V--S--R--I--Y--V--E--D--K--H--K--I--L--Y--C--E--V--P--K--A--G--C--S--N--W--K--R--I--L--M--V--

----------------------------------------------------------------------------------------------------
L--N--G--L--A--S--S--A--Y--N--I--S--H--N--A--V--H--Y--G--K--H--L--K--K--L--D--S--F--D--L--K--G--I--Y
TAAATGGATTGGCTTCCTCTGCATACAACATCTCCCACAATGCTGTCCACTACGGGAAGCATTTGAAGAAGCTAGATAGCTTTGACCTAAAAGGGATATA
: ::::::::::::.:::::::..:::::::.:::::..:::::::.:::::.::::::::::::::.::::: ::::::::::::.:::::::::: ::
TCAATGGATTGGCTCCCTCTGCGCACAACATTTCCCATGATGCTGTTCACTATGGGAAGCATTTGAAAAAGCTCGATAGCTTTGACTTAAAAGGGATTTA
L--N--G--L--A--P--S--A--H--N--I--S--H--D--A--V--H--Y--G--K--H--L--K--K--L--D--S--F--D--L--K--G--I--Y

----------------------------------------------------------------------------------------------------
--T--R--L--N--T--Y--T--K--A--V--F--V--R--D--P--M--E--R--L--V--S--A--F--R--D--K--F--E--H--P--N--S--Y-
TACCCGCTTAAATACTTACACCAAAGCTGTGTTTGTTCGTGATCCCATGGAAAGATTAGTATCAGCCTTTAGGGACAAATTTGAACACCCCAATAGTTAT
:::.:::::::::::.::::::::::::::::::::::::::.:::::::::::::::::.::::: :::::::::::::::::::::::.::::::::.
TACTCGCTTAAATACCTACACCAAAGCTGTGTTTGTTCGTGACCCCATGGAAAGATTAGTGTCAGCATTTAGGGACAAATTTGAACACCCTAATAGTTAC
--T--R--L--N--T--Y--T--K--A--V--F--V--R--D--P--M--E--R--L--V--S--A--F--R--D--K--F--E--H--P--N--S--Y-

----------------------------------------------------------------------------------------------------
-Y--H--P--V--F--G--K--A--I--I--K--K--Y--R--P--N--A--C--E--E--A--L--I--N--G--S--G--V--K--F--K--E--F--
TACCATCCAGTATTCGGAAAGGCAATTATCAAGAAATATCGACCAAATGCCTGTGAAGAAGCATTAATTAATGGATCTGGAGTCAAGTTCAAAGAGTTTA
:::::.::::::::.::.::::::::::: ::::::::.::. :::::::::::::.:::::::::: :::::: :::::::::::.:::::::::::.:
TACCACCCAGTATTTGGGAAGGCAATTATAAAGAAATACCGGGCAAATGCCTGTGAGGAAGCATTAAATAATGGCTCTGGAGTCAAATTCAAAGAGTTCA
-Y--H--P--V--F--G--K--A--I--I--K--K--Y--R--A--N--A--C--E--E--A--L--N--N--G--S--G--V--K--F--K--E--F--

----------------------------------------------------------------------------------------------------
I--H--Y--L--L--D--S--H--R--P--V--G--M--D--I--H--W--E--K--V--S--K--L--C--Y--P--C--L--I--N--Y--D--F--V
TCCACTACTTGCTGGATTCCCACCGTCCAGTAGGAATGGACATTCACTGGGAAAAGGTCAGCAAACTCTGCTATCCGTGTTTGATCAACTATGATTTTGT
:::::::.:::::.:::::::::::.::.:::::::::::.::::::::::::::.::::.:::::::::::::::::::::::::::::::::::::::
TCCACTATTTGCTAGATTCCCACCGCCCGGTAGGAATGGATATTCACTGGGAAAAAGTCAACAAACTCTGCTATCCGTGTTTGATCAACTATGATTTTGT
I--H--Y--L--L--D--S--H--R--P--V--G--M--D--I--H--W--E--K--V--N--K--L--C--Y--P--C--L--I--N--Y--D--F--V

----------------------------------------------------------------------------------------------------
--G--K--F--E--T--L--E--E--D--A--N--Y--F--L--Q--M--I--G--A--P--K--E--L--K--F--P--N--F--K--D--R--H--S-
AGGGAAATTTGAGACTTTGGAAGAAGATGCCAATTACTTTTTACAGATGATCGGTGCTCCAAAGGAGCTGAAATTTCCCAACTTTAAGGATAGGCACTCT
::::::::::::.::::::::.:: :::::.:::::::::::.::: ::::.:: :::                                          
AGGGAAATTTGAAACTTTGGAGGATGATGCTAATTACTTTTTGCAGCTGATTGGAGCT------------------------------------------
--G--K--F--E--T--L--E--D--D--A--N--Y--F--L--Q--L--I--G--A-------------------------------------------

----------------------------------------------------------------------------------------------------
-S--D--E--R--T--N--A--Q--V--V--R--Q--Y--L--K--D--L--T--R--T--E--R--Q--L--I--Y--D--F--Y--Y--L--D--Y--
TCCGATGAAAGAACCAATGCTCAAGTCGTGAGACAGTATTTAAAGGATCTGACTAGAACTGAGAGACAATTAATCTATGACTTTTATTACTTGGACTATT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------->
L--M--F--N--Y--T--T--P--F--L--*-
TAATGTTTAATTATACAACTCCATTTTTGTAG
                                
--------------------------------
--------------------------------

Pig Consensus Sequence

>BGISUST0000879421
---CAGCCGTCTGATGTGGTCATGAACCCCAAACAGGTCTTCTTCTCAGTGCTGATATTTGGGGCAGCAGGGCTGCTCCTCTTCATGTATTTGCAAGTCT
GGATTGAAGAACAACACACA--------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------GCTTTGGGTAGGACCACAGGGTCCCCGATAATTCAGTTGATTG
AAAAACACCTGGAGACTAAGACTTTTTTCAGGAAGTTCAGCGAAATGAATTGGCCGATGGACCCTCGCCCTTTAAACAAAAGCTTAGTCAAAGATAGCAA
ATGGAAAGGAATTGATGCTACTCAAGAAAAACGCAGGTCTTTCCTTCAGGAATTTTGCAAGAAATATGGTGGAGTGAGTCGCCCGCAGTCCCATCTTTTT
CACATGGTATCCAGGATCTATGTAGAAGATAAACACAAAATCTTATACTGTGAAGTACCAAAGGCCGGTTGTTCCAACTGGAAGAGAATTCTGATGGTAC
TCAATGGATTGGCTCCCTCTGCGCACAACATTTCCCATGATGCTGTTCACTATGGGAAGCATTTGAAAAAGCTCGATAGCTTTGACTTAAAAGGGATTTA
TACTCGCTTAAATACCTACACCAAAGCTGTGTTTGTTCGTGACCCCATGGAAAGATTAGTGTCAGCATTTAGGGACAAATTTGAACACCCTAATAGTTAC
TACCACCCAGTATTTGGGAAGGCAATTATAAAGAAATACCGGGCAAATGCCTGTGAGGAAGCATTAAATAATGGCTCTGGAGTCAAATTCAAAGAGTTCA
TCCACTATTTGCTAGATTCCCACCGCCCGGTAGGAATGGATATTCACTGGGAAAAAGTCAACAAACTCTGCTATCCGTGTTTGATCAACTATGATTTTGT
AGGGAAATTTGAAACTTTGGAGGATGATGCTAATTACTTTTTGCAGCTGATTGGAGCT------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------


>BGISUSP0000879421
-QPSDVVMNPKQVFFSVLIFGAAGLLLFMYLQVWIEEQHT------------------------------------------------------------
-------------------ALGRTTGSPIIQLIEKHLETKTFFRKFSEMNWPMDPRPLNKSLVKDSKWKGIDATQEKRRSFLQEFCKKYGGVSRPQSHLF
HMVSRIYVEDKHKILYCEVPKAGCSNWKRILMVLNGLAPSAHNISHDAVHYGKHLKKLDSFDLKGIYTRLNTYTKAVFVRDPMERLVSAFRDKFEHPNSY
YHPVFGKAIIKKYRANACEEALNNGSGVKFKEFIHYLLDSHRPVGMDIHWEKVNKLCYPCLINYDFVGKFETLEDDANYFLQLIGA--------------
--------------------------------------------