Sequences
EST Library Info
ebs3Foetus 50 days, brain stem
fat1Fatt
jca1Joint capsule
Clusters
Oligos
SNPs

Gene ID ENSG00000154096 (click for geneview)
Transcript ID ENST00000284240(link to ensembl)
Symbol THY1
Localtion Chromosome:11:118794097:118800048:-1 band: 11q23.3
Description Thy-1 membrane glycoprotein precursor (Thy-1 antigen) (CDw90) (CD90 antigen). [Source:Uniprot/SWISSPROT;Acc:P04216]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------------------><--------------------------------------------------------------
-M--N--L--A--I--S--I--A--L--L--L--T--V--L--Q--V--S--R--G--Q--K--V--T--S--L--T--A--C--L--V--D--Q--S--
ATGAACCTGGCCATCAGCATCGCTCTCCTGCTAACAGTCTTGCAGGTCTCCCGAGGGCAGAAGGTGACCAGCCTAACGGCCTGCCTAGTGGACCAGAGCC
                                       ::::::::  :::: ::.:::::::::::::::::.::.::::::::.:::::::::::::
---------------------------------------TTGCAGGTGGCCCGTGGACAGAAGGTGACCAGCCTGACAGCCTGCCTGGTGGACCAGAGCC
----------------------------------------L--Q--V--A--R--G--Q--K--V--T--S--L--T--A--C--L--V--D--Q--S--

----------------------------------------------------------------------------------------------------
L--R--L--D--C--R--H--E--N--T--S--S--S--P--I--Q--Y--E--F--S--L--T--R--E--T--K--K--H--V--L--F--G--T--V
TTCGTCTGGACTGCCGCCATGAGAATACCAGCAGTTCACCCATCCAGTACGAGTTCAGCCTGACCCGTGAGACAAAGAAGCACGTGCTCTTTGGCACTGT
:::::::.:::::::::::::::::::::: ::.....:::::.:::::::::::::::::::::::.:::: :::::::::::::::::: ::::::::
TTCGTCTAGACTGCCGCCATGAGAATACCACCAACCTGCCCATTCAGTACGAGTTCAGCCTGACCCGCGAGAAAAAGAAGCACGTGCTCTTGGGCACTGT
L--R--L--D--C--R--H--E--N--T--T--N--L--P--I--Q--Y--E--F--S--L--T--R--E--K--K--K--H--V--L--L--G--T--V

----------------------------------------------------------------------------------------------------
--G--V--P--E--H--T--Y--R--S--R--T--N--F--T--S--K--Y--N--M--K--V--L--Y--L--S--A--F--T--S--K--D--E--G-
GGGGGTGCCTGAGCACACATACCGCTCCCGAACCAACTTCACCAGCAAATACAACATGAAGGTCCTCTACTTATCCGCCTTCACTAGCAAGGACGAGGGC
:::::: ::::::::: : ::::::::.:::::::::::: :::::::.:::.:::: ::::::::::::::::: : :::::::: :::.::.::::: 
GGGGGTCCCTGAGCACTCCTACCGCTCTCGAACCAACTTCTCCAGCAAGTACGACATCAAGGTCCTCTACTTATCAGGCTTCACTACCAAAGATGAGGGG
--G--V--P--E--H--S--Y--R--S--R--T--N--F--S--S--K--Y--D--I--K--V--L--Y--L--S--G--F--T--T--K--D--E--G-

------------------------------------------------------------------------><--------------------------
-T--Y--T--C--A--L--H--H--S--G--H--S--P--P--I--S--S--Q--N--V--T--V--L--R--D--K--L--V--K--C--E--G--I--
ACCTACACGTGTGCACTCCACCACTCTGGCCATTCCCCACCCATCTCCTCCCAGAACGTCACAGTGCTCAGAGACAAACTGGTCAAGTGTGAGGGCATCA
:.::::.:.::.: :::::::: :::::::::  : ::   :::::::  : ::::..:: : :::.:::::   ::::::::::::::::.:::::: :
ATCTACGCATGCGAACTCCACCTCTCTGGCCAGACGCCCAGCATCTCCAGCAAGAATATCTCTGTGTTCAGA---AAACTGGTCAAGTGTGGGGGCATAA
-I--Y--A--C--E--L--H--L--S--G--Q--T--P--S--I--S--S--K--N--I--S--V--F--R-----K--L--V--K--C--G--G--I--

------------------------------------------------------------------------------------->
S--L--L--A--Q--N--T--S--W--L--L--L--L--L--L--S--L--S--L--L--Q--A--T--D--F--M--S--L--*-
GCCTGCTGGCTCAGAACACCTCGTGGCTGCTGCTGCTCCTGCTCTCCCTCTCCCTCCTCCAGGCCACGGATTTCATGTCCCTGTGA
:::::::....::::::::::::::::::::::::::.:::::::: :: .::::::: :::::::.::::::::: :::::::::
GCCTGCTAATCCAGAACACCTCGTGGCTGCTGCTGCTTCTGCTCTCGCTGCCCCTCCTGCAGGCCATGGATTTCATCTCCCTGTGA
S--L--L--I--Q--N--T--S--W--L--L--L--L--L--L--S--L--P--L--L--Q--A--M--D--F--I--S--L--*-

Pig Consensus Sequence

>BGISUST0000880545
---------------------------------------TTGCAGGTGGCCCGTGGACAGAAGGTGACCAGCCTGACAGCCTGCCTGGTGGACCAGAGCC
TTCGTCTAGACTGCCGCCATGAGAATACCACCAACCTGCCCATTCAGTACGAGTTCAGCCTGACCCGCGAGAAAAAGAAGCACGTGCTCTTGGGCACTGT
GGGGGTCCCTGAGCACTCCTACCGCTCTCGAACCAACTTCTCCAGCAAGTACGACATCAAGGTCCTCTACTTATCAGGCTTCACTACCAAAGATGAGGGG
ATCTACGCATGCGAACTCCACCTCTCTGGCCAGACGCCCAGCATCTCCAGCAAGAATATCTCTGTGTTCAGA---AAACTGGTCAAGTGTGGGGGCATAA
GCCTGCTAATCCAGAACACCTCGTGGCTGCTGCTGCTTCTGCTCTCGCTGCCCCTCCTGCAGGCCATGGATTTCATCTCCCTGTGA


>BGISUSP0000880545
-------------LQVARGQKVTSLTACLVDQSLRLDCRHENTTNLPIQYEFSLTREKKKHVLLGTVGVPEHSYRSRTNFSSKYDIKVLYLSGFTTKDEG
IYACELHLSGQTPSISSKNISVFR-KLVKCGGISLLIQNTSWLLLLLLSLPLLQAMDFISL*