Sequences
EST Library Info
aor1Aorta
cje1Jejunum - RNA from China
dbla1Unavailable
eje1Foetus 50 days, jejunum
fat3Fatt
hlv2Heart, left ventricle
isp1M. Infraspinatus
lin2Large intestine
nms3Newborn 115 days, M. semitendinosus
plun2Unavailable
sin2Small intestine
spl4Spleen
ste1M. Semitendinosus
tes1Testes
tra5Trachea
uio4Unavailable
vin6M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000154174 (click for geneview)
Transcript ID ENST00000284320(link to ensembl)
Symbol TOMM70A
Localtion Chromosome:3:101564999:101602932:-1 band: 3q12.2
Description Mitochondrial precursor proteins import receptor (Translocase of outer membrane TOM70). [Source:Uniprot/SWISSPROT;Acc:O94826]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--A--S--K--P--V--E--A--A--V--V--A--A--A--V--P--S--S--G--S--G--V--G--G--G--G-----T--A--G--P--G--
ATGGCCGCCTCTAAACCTGTGGAGGCAGCGGTGGTCGCAGCCGCTGTACCGAGCTCCGGGAGTGGGGTGGGCGGCGGCGGG---ACTGCGGGCCCGGGCA
::::::::::::::::::::::::::.:::::::::::::: :::::.:: ::::::::::::::.::::::::.:::.:    :::.:.::::::::::
ATGGCCGCCTCTAAACCTGTGGAGGCGGCGGTGGTCGCAGCGGCTGTGCCCAGCTCCGGGAGTGGAGTGGGCGGTGGCAGTGCGACTACAGGCCCGGGCA
-M--A--A--S--K--P--V--E--A--A--V--V--A--A--A--V--P--S--S--G--S--G--V--G--G--G--S--A--T--T--G--P--G--

----------------------------------------------------------------------------------------------------
T--G--G--L--P--R--W--Q--L--A--L--A--V--G--A--P--L--L--L--G--A--G--A--I--Y--L--W--S--R--Q--Q--R--R--R
CGGGGGGGCTGCCGCGATGGCAGCTGGCTCTGGCGGTCGGGGCACCCCTGCTGCTGGGCGCGGGTGCCATATACCTGTGGAGTCGGCAGCAACGGCGCCG
: ::::: ::::::::::::::::: ::.:::::.:::::.::.::::::::::::::::::::::::::.:::::::::::.:::::::..::::::::
CCGGGGGCCTGCCGCGATGGCAGCTCGCCCTGGCAGTCGGAGCGCCCCTGCTGCTGGGCGCGGGTGCCATGTACCTGTGGAGCCGGCAGCGGCGGCGCCG
T--G--G--L--P--R--W--Q--L--A--L--A--V--G--A--P--L--L--L--G--A--G--A--M--Y--L--W--S--R--Q--R--R--R--R

----------------------------------------------------------------------------------------------------
--E--A--R--G--R--G--D--A--S--G--L--K--R--N--S--E--R--K--T--P--E--G--R--A--S--P--A--P--G--S--G--H--P-
GGAGGCCAGAGGCCGGGGCGACGCCAGCGGCCTGAAGCGCAACAGCGAACGGAAGACCCCGGAGGGCAGGGCCAGTCCGGCCCCGGGCAGCGGACACCCT
::::.::.:.:::::.:::::::::.:::::::::::::::::::.:::::::::::::::::::::::::: ::::::::.:::::::::::::::::.
GGAGACCGGGGGCCGAGGCGACGCCGGCGGCCTGAAGCGCAACAGTGAACGGAAGACCCCGGAGGGCAGGGCAAGTCCGGCTCCGGGCAGCGGACACCCC
--E--T--G--G--R--G--D--A--G--G--L--K--R--N--S--E--R--K--T--P--E--G--R--A--S--P--A--P--G--S--G--H--P-

--------------------------><------------------------------------------------------------------------
-E--G--P--G--A--H--L--D--M--N--S--L--D--R--A--Q--A--A--K--N--K--G--N--K--Y--F--K--A--G--K--Y--E--Q--
GAAGGTCCCGGTGCTCACTTGGACATGAACTCTCTTGATAGAGCCCAAGCAGCCAAGAATAAAGGCAATAAATATTTTAAAGCAGGAAAATATGAACAAG
:::::.::::::::::::.:::: :::::::::::::::::::::::::::::::::::.::::::::.:::::::::::::::::::::::::::::::
GAAGGCCCCGGTGCTCACCTGGAAATGAACTCTCTTGATAGAGCCCAAGCAGCCAAGAACAAAGGCAACAAATATTTTAAAGCAGGAAAATATGAACAAG
-E--G--P--G--A--H--L--E--M--N--S--L--D--R--A--Q--A--A--K--N--K--G--N--K--Y--F--K--A--G--K--Y--E--Q--

----------------------------------------------------------------------------------------------------
A--I--Q--C--Y--T--E--A--I--S--L--C--P--T--E--K--N--V--D--L--S--T--F--Y--Q--N--R--A--A--A--F--E--Q--L
CTATTCAGTGCTATACTGAGGCTATTAGCTTGTGCCCTACAGAGAAGAATGTTGACCTTTCTACATTTTATCAAAACAGAGCTGCTGCCTTTGAACAGTT
:::::::::::::::::::::::::.::.::::::::::::::::::::.:::::::::::.::.:::::::::::::::::::::::::::::.:::::
CTATTCAGTGCTATACTGAGGCTATCAGTTTGTGCCCTACAGAGAAGAACGTTGACCTTTCCACGTTTTATCAAAACAGAGCTGCTGCCTTTGAGCAGTT
A--I--Q--C--Y--T--E--A--I--S--L--C--P--T--E--K--N--V--D--L--S--T--F--Y--Q--N--R--A--A--A--F--E--Q--L

><--------------------------------------------------------------------------------------------------
--Q--K--W--K--E--V--A--Q--D--C--T--K--A--V--E--L--N--P--K--Y--V--K--A--L--F--R--R--A--K--A--H--E--K-
GCAAAAATGGAAAGAAGTGGCACAAGACTGTACAAAAGCTGTTGAACTTAATCCCAAATATGTGAAAGCTCTCTTTAGACGTGCAAAAGCCCATGAGAAG
:::::::::::::::.:::::::::::.::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::
GCAAAAATGGAAAGAGGTGGCACAAGATTGTACAAAGGCTGTTGAACTTAATCCCAAATATGTGAAAGCTCTCTTTAGACGTGCAAAAGCCCACGAGAAG
--Q--K--W--K--E--V--A--Q--D--C--T--K--A--V--E--L--N--P--K--Y--V--K--A--L--F--R--R--A--K--A--H--E--K-

---------------------------><-----------------------------------------------------------------------
-L--D--N--K--K--E--C--L--E--D--V--T--A--V--C--I--L--E--G--F--Q--N--Q--Q--S--M--L--L--A--D--K--V--L--
CTAGACAATAAGAAGGAATGTTTAGAAGATGTCACTGCTGTGTGTATATTAGAAGGGTTCCAAAATCAACAAAGCATGCTGTTAGCCGATAAAGTTCTTA
:::::::::::::::::::::::::::   ::::: ::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::
CTAGACAATAAGAAGGAATGTTTAGAA---GTCACAGCTGTGTGTATATTAGAAGGGTTCCAAAATCAACAAAGCATGCTGTTAGCTGATAAAGTTCTTA
-L--D--N--K--K--E--C--L--E-----V--T--A--V--C--I--L--E--G--F--Q--N--Q--Q--S--M--L--L--A--D--K--V--L--

-------------------------------------><-------------------------------------------------------------
K--L--L--G--K--E--K--A--K--E--K--Y--K--N--R--E--P--L--M--P--S--P--Q--F--I--K--S--Y--F--S--S--F--T--D
AACTCCTTGGAAAAGAGAAAGCCAAAGAAAAATATAAGAATCGTGAACCTCTGATGCCATCTCCACAGTTTATCAAATCTTACTTCAGTTCTTTCACGGA
::::.:::::.:::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:: ::
AACTTCTTGGGAAAGAGAAAGCCAAAGAAAAATACAAGAATCGTGAACCTCTGATGCCATCTCCACAGTTTATCAAATCTTACTTCAGTTCTTTTACTGA
K--L--L--G--K--E--K--A--K--E--K--Y--K--N--R--E--P--L--M--P--S--P--Q--F--I--K--S--Y--F--S--S--F--T--D

--------------------------------------------------------------------------------------><------------
--D--I--I--S--Q--P--M--L--K--G--E--K--S--D--E--D--K--D--K--E--G--E--A--L--E--V--K--E--N--S--G--Y--L-
TGATATCATTTCCCAGCCCATGCTTAAAGGAGAGAAATCTGATGAAGATAAAGACAAGGAAGGGGAGGCTTTAGAAGTGAAAGAAAATTCTGGATACTTA
:::::: :::::.::::: :::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::   ::::::::.:::
TGATATAATTTCTCAGCCAATGCTTAAAGGAGAGAAGTCTGATGAAGATAAAGACAAGGAAGGGGAGGCTTTAGAAGTGAAAGAA---TCTGGATATTTA
--D--I--I--S--Q--P--M--L--K--G--E--K--S--D--E--D--K--D--K--E--G--E--A--L--E--V--K--E-----S--G--Y--L-

----------------------------------------------------------------------------------------------------
-K--A--K--Q--Y--M--E--E--E--N--Y--D--K--I--I--S--E--C--S--K--E--I--D--A--E--G--K--Y--M--A--E--A--L--
AAGGCCAAACAGTATATGGAAGAAGAAAACTACGATAAAATCATAAGTGAATGCTCAAAAGAAATAGATGCTGAAGGCAAATACATGGCAGAAGCATTGC
::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::: ::::::::::.::::::::::::::..
AAGGCCAAACAGTATATGGAAGAAGAAAACTATGATAAAATCATAAGTGAATGCTCAAAAGAAATAGATGCTCAAGGCAAATATATGGCAGAAGCATTAT
-K--A--K--Q--Y--M--E--E--E--N--Y--D--K--I--I--S--E--C--S--K--E--I--D--A--Q--G--K--Y--M--A--E--A--L--

----------------------------------------------------------------------------------------------><----
L--L--R--A--T--F--Y--L--L--I--G--N--A--N--A--A--K--P--D--L--D--K--V--I--S--L--K--E--A--N--V--K--L--R
TACTACGAGCTACCTTCTACCTGCTTATTGGCAATGCCAATGCAGCCAAACCAGATTTAGATAAAGTCATCAGTTTGAAAGAAGCTAATGTGAAGCTTCG
::::::::::::::::::::::::: ::::::::.:::::.:::::::::::::::::::::::.::::::::.:::::::::::::::::::::::.::
TACTACGAGCTACCTTCTACCTGCTAATTGGCAACGCCAACGCAGCCAAACCAGATTTAGATAAGGTCATCAGCTTGAAAGAAGCTAATGTGAAGCTCCG
L--L--R--A--T--F--Y--L--L--I--G--N--A--N--A--A--K--P--D--L--D--K--V--I--S--L--K--E--A--N--V--K--L--R

----------------------------------------------------------------------------------------------------
--A--N--A--L--I--K--R--G--S--M--Y--M--Q--Q--Q--Q--P--L--L--S--T--Q--D--F--N--M--A--A--D--I--D--P--Q-
AGCAAATGCTCTCATCAAAAGAGGCAGCATGTACATGCAACAGCAGCAGCCTTTGCTGTCCACTCAAGATTTTAACATGGCTGCTGACATCGATCCTCAG
::::::::::::.::::::::::::::::::::::::::::::::.::::::::::::::.:::::.:::::::::::::::::.:::::.:::::::::
AGCAAATGCTCTTATCAAAAGAGGCAGCATGTACATGCAACAGCAACAGCCTTTGCTGTCTACTCAGGATTTTAACATGGCTGCCGACATTGATCCTCAG
--A--N--A--L--I--K--R--G--S--M--Y--M--Q--Q--Q--Q--P--L--L--S--T--Q--D--F--N--M--A--A--D--I--D--P--Q-

-----------------------------><---------------------------------------------------------------------
-N--A--D--V--Y--H--H--R--G--Q--L--K--I--L--L--D--Q--V--E--E--A--V--A--D--F--D--E--C--I--R--L--R--P--
AATGCAGATGTTTATCACCACCGAGGACAGCTGAAAATACTCCTTGATCAAGTTGAAGAAGCAGTGGCAGATTTTGATGAATGTATTAGGTTAAGACCTG
::::: :::::::::::::::::::::::::::::::::.: ::::::::::::::::::::::::::::::::::::::::::::: :.::::::::.:
AATGCTGATGTTTATCACCACCGAGGACAGCTGAAAATATTGCTTGATCAAGTTGAAGAAGCAGTGGCAGATTTTGATGAATGTATTCGATTAAGACCCG
-N--A--D--V--Y--H--H--R--G--Q--L--K--I--L--L--D--Q--V--E--E--A--V--A--D--F--D--E--C--I--R--L--R--P--

-------------------------------------><-------------------------------------------------------------
E--S--A--L--A--Q--A--Q--K--C--F--A--L--Y--R--Q--A--Y--T--G--N--N--S--S--Q--I--Q--A--A--M--K--G--F--E
AGTCTGCTCTGGCACAAGCACAGAAATGTTTTGCATTGTACCGCCAGGCATATACGGGAAACAACTCTTCACAAATCCAAGCAGCTATGAAAGGTTTTGA
::::::::::::::::::: ::::::::::::::::::::.::::::::::::::.::::::::.:::::::::::::::::::::::::::::::::::
AGTCTGCTCTGGCACAAGCTCAGAAATGTTTTGCATTGTATCGCCAGGCATATACAGGAAACAATTCTTCACAAATCCAAGCAGCTATGAAAGGTTTTGA
E--S--A--L--A--Q--A--Q--K--C--F--A--L--Y--R--Q--A--Y--T--G--N--N--S--S--Q--I--Q--A--A--M--K--G--F--E

------------------------------------------------------><--------------------------------------------
--E--V--I--K--K--F--P--R--C--A--E--G--Y--A--L--Y--A--Q--A--L--T--D--Q--Q--Q--F--G--K--A--D--E--M--Y-
AGAGGTCATAAAGAAATTTCCAAGGTGTGCCGAAGGCTATGCACTATACGCCCAGGCATTAACAGATCAACAACAGTTTGGTAAAGCTGATGAAATGTAT
::::::::::::.::::::::::.::::::.::::::::::::.::::.:::::::::::::::::::::::.:::::::::::::::::::::::::::
AGAGGTCATAAAAAAATTTCCAAAGTGTGCTGAAGGCTATGCATTATATGCCCAGGCATTAACAGATCAACAGCAGTTTGGTAAAGCTGATGAAATGTAT
--E--V--I--K--K--F--P--K--C--A--E--G--Y--A--L--Y--A--Q--A--L--T--D--Q--Q--Q--F--G--K--A--D--E--M--Y-

----------------------------------------------------><----------------------------------------------
-D--K--C--I--D--L--E--P--D--N--A--T--T--Y--V--H--K--G--L--L--Q--L--Q--W--K--Q--D--L--D--R--G--L--E--
GATAAATGTATTGATTTGGAACCAGATAATGCTACAACATATGTTCATAAAGGTTTACTTCAACTTCAGTGGAAGCAAGATCTGGATAGAGGTTTGGAAC
::::::::::::::::::::::::::::::::.::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::.:
GATAAATGTATTGATTTGGAACCAGATAATGCCACAACATATGTTCATAAA---TTACTTCAACTTCAGTGGAAGCAAGATCTGGATAGAGGTTTGGAGC
-D--K--C--I--D--L--E--P--D--N--A--T--T--Y--V--H--K-----L--L--Q--L--Q--W--K--Q--D--L--D--R--G--L--E--

---------------------------------------------------------------------------><-----------------------
L--I--S--K--A--I--E--I--D--N--K--C--D--F--A--Y--E--T--M--G--T--I--E--V--Q--R--G--N--M--E--K--A--I--D
TTATCAGCAAGGCTATTGAAATTGACAATAAATGTGATTTTGCCTATGAAACCATGGGAACTATTGAAGTACAAAGAGGAAACATGGAGAAAGCCATTGA
:::::::::::::::::::::::::::::::.::::::::::: ::::::::::::::::::::::::::::::   :::::::::::.:::::::::::
TTATCAGCAAGGCTATTGAAATTGACAATAAGTGTGATTTTGCATATGAAACCATGGGAACTATTGAAGTACAA---GGAAACATGGAAAAAGCCATTGA
L--I--S--K--A--I--E--I--D--N--K--C--D--F--A--Y--E--T--M--G--T--I--E--V--Q-----G--N--M--E--K--A--I--D

----------------------------------------------------------------------------------------------------
--M--F--N--K--A--I--N--L--A--K--S--E--M--E--M--A--H--L--Y--S--L--C--D--A--A--H--A--Q--T--E--V--A--K-
CATGTTCAACAAAGCTATTAACCTGGCCAAATCGGAAATGGAGATGGCCCATCTGTATTCACTTTGCGATGCCGCCCATGCCCAGACAGAAGTTGCAAAG
:::::::::::::::::::::::::::::::::.::::::::::::::.::::: ::.:::::.::.:::::.:::::::::::::::::::::::::::
CATGTTCAACAAAGCTATTAACCTGGCCAAATCAGAAATGGAGATGGCTCATCTCTACTCACTCTGTGATGCTGCCCATGCCCAGACAGAAGTTGCAAAG
--M--F--N--K--A--I--N--L--A--K--S--E--M--E--M--A--H--L--Y--S--L--C--D--A--A--H--A--Q--T--E--V--A--K-

----------------------------->
-K--Y--G--L--K--P--P--T--L--*-
AAATACGGATTAAAACCACCAACATTATAA
:::::.::::::::::::::::::::.:::
AAATATGGATTAAAACCACCAACATTGTAA
-K--Y--G--L--K--P--P--T--L--*-

Pig Consensus Sequence

>BGISUST0000880219
ATGGCCGCCTCTAAACCTGTGGAGGCGGCGGTGGTCGCAGCGGCTGTGCCCAGCTCCGGGAGTGGAGTGGGCGGTGGCAGTGCGACTACAGGCCCGGGCA
CCGGGGGCCTGCCGCGATGGCAGCTCGCCCTGGCAGTCGGAGCGCCCCTGCTGCTGGGCGCGGGTGCCATGTACCTGTGGAGCCGGCAGCGGCGGCGCCG
GGAGACCGGGGGCCGAGGCGACGCCGGCGGCCTGAAGCGCAACAGTGAACGGAAGACCCCGGAGGGCAGGGCAAGTCCGGCTCCGGGCAGCGGACACCCC
GAAGGCCCCGGTGCTCACCTGGAAAACTCTCTTGATAGAGCCCAAGCAGCCAAGAACAAAGGCAACAAATATTTTAAAGCAGGAAAATATGAACAAGCTA
TTCAGTGCTATACTGAGGCTATCAGTTTGTGCCCTACAGAGAAGAACGTTGACCTTTCCACGTTTTATCAAAACAGAGCTGCTGCCTTTGAGCAGTTGCA
AAAATGGAAAGAGGTGGCACAAGATTGTACAAAGGCTGTTGAACTTAATCCCAAATATGTGAAAGCTCTCTTTAGACGTGCAAAAGCCCACGAGAAGCTA
GACAATAAGAAGGAATGTTTAGAA---GTCACAGCTGTGTGTATATTAGAAGGGTTCCAAAATCAACAAAGCATGCTGTTAGCTGATAAAGTTCTTAAAC
TTCTTGGGAAAGAGAAAGCCAAAGAAAAATACAAGAATCGTGAACCTCTGATGCCATCTCCACAGTTTATCAAATCTTACTTCAGTTCTTTTACTGATGA
TATAATTTCTCAGCCAATGCTTAAAGGAGAGAAGTCTGATGAAGATAAAGACAAGGAAGGGGAGGCTTTAGAAGTGAAAGAA---TCTGGATATTTAAAG
GCCAAACAGTATATGGAAGAAGAAAACTATGATAAAATCATAAGTGAATGCTCAAAAGAAATAGATGCTCAAGGCAAATATATGGCAGAAGCATTATTAC
TACGAGCTACCTTCTACCTGCTAATTGGCAACGCCAACGCAGCCAAACCAGATTTAGATAAGGTCATCAGCTTGAAAGAAGCTAATGTGAAGCTCCGAGC
AAATGCTCTTATCAAAAGAGGCAGCATGTACATGCAACAGCAACAGCCTTTGCTGTCTACTCAGGATTTTAACATGGCTGCCGACATTGATCCTCAGAAT
GCTGATGTTTATCACCACCGAGGACAGCTGAAAATATTGCTTGATCAAGTTGAAGAAGCAGTGGCAGATTTTGATGAATGTATTCGATTAAGACCCGAGT
CTGCTCTGGCACAAGCTCAGAAATGTTTTGCATTGTATCGCCAGGCATATACAGGAAACAATTCTTCACAAATCCAAGCAGCTATGAAAGGTTTTGAAGA
GGTCATAAAAAAATTTCCAAAGTGTGCTGAAGGCTATGCATTATATGCCCAGGCATTAACAGATCAACAGCAGTTTGGTAAAGCTGATGAAATGTATGAT
AAATGTATTGATTTGGAACCAGATAATGCCACAACATATGTTCATAAA---TTACTTCAACTTCAGTGGAAGCAAGATCTGGATAGAGGTTTGGAGCTTA
TCAGCAAGGCTATTGAAATTGACAATAAGTGTGATTTTGCATATGAAACCATGGGAACTATTGAAGTACAA---GGAAACATGGAAAAAGCCATTGACAT
GTTCAACAAAGCTATTAACCTGGCCAAATCAGAAATGGAGATGGCTCATCTCTACTCACTCTGTGATGCTGCCCATGCCCAGACAGAAGTTGCAAAGAAA
TATGGATTAAAACCACCAACATTGTAA


>BGISUSP0000880219
MAASKPVEAAVVAAAVPSSGSGVGGGSATTGPGTGGLPRWQLALAVGAPLLLGAGAMYLWSRQRRRRETGGRGDAGGLKRNSERKTPEGRASPAPGSGHP
EGPGAHLENSLDRAQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEVAQDCTKAVELNPKYVKALFRRAKAHEKL
DNKKECLE-VTAVCILEGFQNQQSMLLADKVLKLLGKEKAKEKYKNREPLMPSPQFIKSYFSSFTDDIISQPMLKGEKSDEDKDKEGEALEVKE-SGYLK
AKQYMEEENYDKIISECSKEIDAQGKYMAEALLLRATFYLLIGNANAAKPDLDKVISLKEANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQN
ADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPKCAEGYALYAQALTDQQQFGKADEMYD
KCIDLEPDNATTYVHK-LLQLQWKQDLDRGLELISKAIEIDNKCDFAYETMGTIEVQ-GNMEKAIDMFNKAINLAKSEMEMAHLYSLCDAAHAQTEVAKK
YGLKPPTL*