Sequences
EST Library Info
mcp2Mammae, collostrum producing
Clusters
Oligos
SNPs

Gene ID ENSG00000156050 (click for geneview)
Transcript ID ENST00000286544(link to ensembl)
Symbol CN044_HUMAN
Localtion Chromosome:14:73470458:73486588:-1 band: 14q24.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------------------><---------------------------------------------
-M--T--V--G--R--P--E--G--A--P--G--G--A--E--G--S--R--Q--I--F--P--P--E--S--F--A--D--T--E--A--G--E--E--
ATGACCGTGGGGAGGCCTGAGGGAGCCCCCGGAGGCGCGGAGGGGAGCCGTCAGATATTTCCCCCCGAGTCCTTCGCAGACACAGAGGCAGGAGAGGAGC
                                                      ::.:::::::::.:.::::.: :::::::::::.:::.:::: :::
------------------------------------------------------ATGTTTCCCCCCAAATCCTCCTCAGACACAGAGACAGAAGAGCAGC
-------------------------------------------------------M--F--P--P--K--S--S--S--D--T--E--T--E--E--Q--

----------------------------------------------------------------------------------------------------
L--S--G--D--G--L--V--L--P--R--A--S--K--L--D--E--F--L--S--P--E--E--E--I--D--S--T--S--D--S--T--G--S--I
TGTCCGGGGATGGGCTGGTTTTGCCCAGGGCCAGCAAACTTGACGAGTTCCTCAGCCCAGAGGAGGAGATAGATTCTACTTCTGACTCAACTGGGAGCAT
.:.:.:::::::::::::::::::::::.::..:::..::....:::::::::::::::::::::::::.:::::::::::::::.::::: :::::: :
CGCCTGGGGATGGGCTGGTTTTGCCCAGAGCTGGCAGGCTCAGTGAGTTCCTCAGCCCAGAGGAGGAGACAGATTCTACTTCTGATTCAACGGGGAGCTT
P--P--G--D--G--L--V--L--P--R--A--G--R--L--S--E--F--L--S--P--E--E--E--T--D--S--T--S--D--S--T--G--S--F

----------------------------------------------------------------------------------------------------
--Y--Q--N--L--Q--E--L--K--Q--K--G--R--W--C--L--L--E--S--L--F--Q--S--D--P--E--S--D--E--N--L--S--E--D-
TTACCAGAACTTACAGGAACTGAAGCAGAAAGGGAGATGGTGTCTGTTGGAGTCTCTCTTTCAGTCTGACCCAGAGAGTGATGAAAACCTCTCTGAAGAT
:::. ::: :.:.::.: .::::.::::::::: ::.:::::.::::::::.::.::.: ::  ::::::::::: :::::::..:.:::::::::::::
TTATGAGACCCTGCAAGCGCTGAGGCAGAAAGGCAGGTGGTGCCTGTTGGAATCCCTTTATCCCTCTGACCCAGACAGTGATGGGAGCCTCTCTGAAGAT
--Y--E--T--L--Q--A--L--R--Q--K--G--R--W--C--L--L--E--S--L--Y--P--S--D--P--D--S--D--G--S--L--S--E--D-

-------------------------------------------------------------------------><-------------------------
-E--E--D--L--E--S--F--F--Q--D--K--D--R--G--M--V--Q--V--Q--C--P--Q--A--L--R--C--G--S--T--R--R--C--S--
GAGGAGGACCTGGAGAGTTTCTTCCAAGACAAGGACAGGGGGATGGTGCAGGTCCAGTGCCCGCAGGCTCTGAGGTGTGGCTCCACAAGGCGCTGCAGCT
:: ::::::::::: :::::::::::::::::.:.:::::::: : ..::::: ::                   ::.::::::: :::.:::::: .::
GACGAGGACCTGGACAGTTTCTTCCAAGACAAAGGCAGGGGGAAGCCACAGGTGCAC------------------TGCGGCTCCAGAAGACGCTGCCACT
-D--E--D--L--D--S--F--F--Q--D--K--G--R--G--K--P--Q--V--H--------------------C--G--S--R--R--R--C--H--

----------------------------------------------------------------------------------------------------
S--L--N--N--L--P--S--N--I--P--R--P--Q--T--Q--P--P--S--G--S--R--P--P--S--Q--H--R--S--V--S--S--W--A--S
CCCTGAACAACCTTCCCTCCAACATTCCCAGGCCTCAGACCCAGCCACCCTCAGGCTCCCGGCCTCCCTCCCAGCACAGAAGCGTCAGCTCCTGGGCATC
::::::.: :::: :::  ..::      :  ::.  :.:.::::::::::: :::::: :::::::::::::::::::::::.::::::::::::::::
CCCTGAGCCACCTGCCCAGTGAC------ACCCCCACGGCTCAGCCACCCTCTGGCTCCAGGCCTCCCTCCCAGCACAGAAGCATCAGCTCCTGGGCATC
S--L--S--H--L--P--S--D--------T--P--T--A--Q--P--P--S--G--S--R--P--P--S--Q--H--R--S--I--S--S--W--A--S

----------------------------------------------------------------------------------------------------
--S--I--T--V--P--R--P--F--R--M--T--L--R--E--A--R--K--K--A--E--W--L--G--S--P--A--S--F--E--Q--E--R--Q-
ATCCATTACTGTCCCTCGGCCATTCCGCATGACGCTGCGCGAGGCCCGGAAGAAGGCCGAGTGGCTGGGCTCACCTGCCTCCTTTGAGCAGGAGAGGCAG
::::::.::.:::::::.::::::::::::::::::::: :::::: ::::::::::: ::::::::: ::: ::::::::.:::::::: :::::::::
ATCCATCACCGTCCCTCAGCCATTCCGCATGACGCTGCGAGAGGCCAGGAAGAAGGCCCAGTGGCTGGCCTCCCCTGCCTCTTTTGAGCACGAGAGGCAG
--S--I--T--V--P--Q--P--F--R--M--T--L--R--E--A--R--K--K--A--Q--W--L--A--S--P--A--S--F--E--H--E--R--Q-

----------------------------------------------------------------------------------------------------
-R--A--Q--R--Q--G--E--E--E--A--E--C--H--R--Q--F--R--A--Q--P--V--P--A--H--V--Y--L--P--L--Y--Q--E--I--
CGGGCCCAGAGGCAGGGTGAGGAAGAGGCCGAGTGCCACAGGCAGTTCCGGGCACAGCCTGTGCCTGCACATGTCTACCTGCCCCTCTACCAAGAGATCA
:.::::::::.::::::. ::::.::::::::::::::: :::::::::::::::::::.::::::::.:::::::::::::::::::::::.::::::.
CAGGCCCAGAAGCAGGGCCAGGAGGAGGCCGAGTGCCACCGGCAGTTCCGGGCACAGCCCGTGCCTGCGCATGTCTACCTGCCCCTCTACCAGGAGATCG
-Q--A--Q--K--Q--G--Q--E--E--A--E--C--H--R--Q--F--R--A--Q--P--V--P--A--H--V--Y--L--P--L--Y--Q--E--I--

----------------------------------------------------------------------------------------------------
M--E--R--S--E--A--R--R--Q--A--G--I--Q--K--R--K--E--L--L--L--S--S--L--K--P--F--S--F--L--E--K--E--E--Q
TGGAGCGCAGCGAGGCCCGAAGGCAGGCAGGGATCCAGAAGAGGAAGGAACTGCTCCTCTCTTCTTTGAAGCCCTTCAGCTTCCTGGAGAAGGAGGAGCA
:::::::::::::::: :: ::::.:::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::
TGGAGCGCAGCGAGGCGCGCAGGCGGGCAGGGATCCAGAAGAGGAAGGAACTGCTCCTCTCTTCCTTGAAGCCCTTCAGCTTCCTGGAGAAGGAGGAGCA
V--E--R--S--E--A--R--R--R--A--G--I--Q--K--R--K--E--L--L--L--S--S--L--K--P--F--S--F--L--E--K--E--E--Q

----------------------------------------------------------------------------------------------------
--L--K--E--A--A--R--Q--R--D--L--A--A--T--A--E--A--K--I--S--K--Q--K--A--T--R--R--I--P--K--S--I--L--E-
GCTAAAGGAAGCTGCTCGACAGAGAGACTTGGCAGCCACAGCTGAAGCCAAGATCTCCAAGCAGAAGGCCACCAGAAGGATTCCCAAGTCCATTCTGGAG
:: ::::.:::::::::.::::::.:::::::: :::.:::::.:.:.:::..::.::::::::::::::::::..:::::.::::::::::::::::::
GCGAAAGAAAGCTGCTCAACAGAGGGACTTGGCCGCCGCAGCTAAGGTCAAAGTCCCCAAGCAGAAGGCCACCAAGAGGATCCCCAAGTCCATTCTGGAG
--R--K--K--A--A--Q--Q--R--D--L--A--A--A--A--K--V--K--V--P--K--Q--K--A--T--K--R--I--P--K--S--I--L--E-

------------------------><--------------------------------------------------------------------------
-P--A--L--G--D--K--L--Q--E--A--E--L--F--R--K--I--R--I--Q--M--R--A--L--D--M--L--Q--M--A--S--S--P--I--
CCAGCCCTTGGGGATAAACTCCAGGAAGCTGAGCTCTTCAGGAAAATTCGCATCCAAATGAGAGCCCTGGACATGCTCCAGATGGCCTCTTCCCCTATCG
:: .::::.:::::.::::::      ::::::::::: :::::::::::::::::.:::::::::::::::::::: :::::::::::.:::::.::: 
CCCACCCTCGGGGACAAACTC------GCTGAGCTCTTGAGGAAAATTCGCATCCAGATGAGAGCCCTGGACATGCTGCAGATGGCCTCCTCCCCCATCC
-P--T--L--G--D--K--L--------A--E--L--L--R--K--I--R--I--Q--M--R--A--L--D--M--L--Q--M--A--S--S--P--I--

----------------------------------------------------------------------------------------------------
A--S--S--S--N--R-----A--N--P--Q--P--R--T--A--T--R--T--Q--Q--E--K--L--G--F--L--H--T--N--F--R--F--Q--P
CCTCCTCTAGTAACCGG---GCTAACCCACAGCCCCGCACAGCCACCCGAACCCAGCAGGAAAAGCTTGGGTTTCTGCACACTAACTTCAGATTCCAGCC
: :::::.::::.:::    :::.:::::::::..::::::::::::::.::::.: :::::::::::::::::::::: :::.::::..::::::::::
CGTCCTCCAGTAGCCGCCGGGCTGACCCACAGCTTCGCACAGCCACCCGGACCCGGAAGGAAAAGCTTGGGTTTCTGCAAACTGACTTTGGATTCCAGCC
P--S--S--S--S--R--R--A--D--P--Q--L--R--T--A--T--R--T--R--K--E--K--L--G--F--L--Q--T--D--F--G--F--Q--P

----------------------------------------------------------------------------------------------------
--R--V--N--P--V--V--P--D--Y--E--G--L--Y--K--A--F--Q--R--R--A--A--K--R--R--E--T--Q--E--A--T--R--N--K-
TCGGGTGAATCCTGTGGTCCCTGACTATGAGGGCCTTTACAAGGCCTTCCAGAGAAGAGCAGCCAAAAGAAGAGAAACCCAAGAGGCCACTCGCAACAAG
::::::::::::::: :::::::::::::::::::::::::::::::::::::.:::::: :::::.:::::.:: ::  ..::::. ::.:::::::::
TCGGGTGAATCCTGTCGTCCCTGACTATGAGGGCCTTTACAAGGCCTTCCAGAAAAGAGCCGCCAAGAGAAGGGACACGAGGGAGGTGACCCGCAACAAG
--R--V--N--P--V--V--P--D--Y--E--G--L--Y--K--A--F--Q--K--R--A--A--K--R--R--D--T--R--E--V--T--R--N--K-

-----------------------------------------------------------------------------><---------------------
-P--F--L--L--R--T--A--N--L--R--H--P--Q--R--P--C--D-----A--A--T--T--G--R--R--Q--D--S--P--Q--P--P--A--
CCCTTCTTGCTGAGGACCGCCAACCTGCGCCACCCTCAGCGGCCCTGTGAT---GCTGCCACCACCGGAAGGAGGCAGGATTCCCCACAGCCACCAGCTA
::::::::::::::.:::::::.::::::.::: ::. .::::::::::::   :::::: :..  ::.:::                            
CCCTTCTTGCTGAGAACCGCCAGCCTGCGTCACACTTCACGGCCCTGTGATGTCGCTGCCTCTGAAGGGAGG----------------------------
-P--F--L--L--R--T--A--S--L--R--H--T--S--R--P--C--D--V--A--A--S--E--G--R-----------------------------

----------------------------------------------------------------------------------------------------
T--P--L--P--R--S--R--S--L--S--G--L--A--S--L--S--A--N--T--L--P--V--H--I--T--D--A--T--R--K--R--E--S--A
CACCCCTGCCAAGGAGTCGTTCTCTGAGCGGCCTTGCTTCCCTCTCTGCCAACACTCTCCCTGTGCACATCACAGATGCCACCAGGAAGAGGGAATCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----><---------------------------------------------------------------------------------------------
--V--R--S--A--L--E--K--K--N--K--A--D--E--S--I--Q--W--L--E--I--H--K--K--K--S--Q--A--M--S--K--S--V--T-
AGTCAGAAGTGCACTTGAAAAAAAGAACAAAGCAGATGAGAGTATTCAGTGGCTGGAGATACACAAAAAGAAGTCTCAAGCAATGTCCAAATCTGTGACC
                                                                   :.::::: ::::: .::.:: :::::::::::.
-------------------------------------------------------------------AGGAAGTGTCAAGAGATATCGAAATCTGTGACT
--------------------------------------------------------------------R--K--C--Q--E--I--S--K--S--V--T-

----------------------------------------------------------------------><----------------------------
-L--R--A--K--A--M--D--P--H--K--S--L--E--E--V--F--K--A--K--L--K--E--N--R--N--N--D--R--K--R--A--K--E--
TTGCGTGCAAAAGCCATGGATCCCCATAAAAGCCTGGAGGAAGTGTTCAAAGCAAAGCTGAAAGAGAACCGGAACAATGACCGTAAAAGAGCGAAAGAAT
::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::      ::::::::::::::::::::.:::::.:
TTGCGTGCAAAAGCCATGGATCCCCATAAAAGCCTGGAGGAAGTATTCAAAGCAAAGCTGAAAGAG------AACAATGACCGTAAAAGAGCAAAAGAGT
-L--R--A--K--A--M--D--P--H--K--S--L--E--E--V--F--K--A--K--L--K--E--------N--N--D--R--K--R--A--K--E--

-------------------------------------------------------------------------><-------------------------
Y--K--K--E--L--E--E--M--K--Q--R--I--Q--T--R--P--Y--L--F--E--Q--V--A--K--D--L--A--K--K--E--A--E--Q--W
ATAAGAAAGAACTGGAGGAAATGAAGCAGCGAATACAAACAAGGCCCTATCTCTTTGAACAAGTTGCCAAGGATCTAGCCAAGAAAGAAGCAGAACAGTG
::::::::::::::::::::::::.. .  :::::::::.:::::::::::::::::::::::::.:::::                             
ATAAGAAAGAACTGGAGGAAATGAGAAG-AGAATACAAATAAGGCCCTATCTCTTTGAACAAGTTACCAAG-----------------------------
Y--K--K--E--L--E--E--M--R--Q--R--I--Q--I--R--P--Y--L--F--E--Q--V--T--K------------------------------

----------------------------------------------------------------------------------------------------
--Y--L--D--T--L--K--Q--A--G--L--E--E--D--F--V--R--N--K--G--Q--G--T--R--A--V--Q--E--K--E--T--K--I--K-
GTATCTAGACACCCTGAAGCAGGCTGGGCTGGAGGAAGACTTTGTGAGAAACAAGGGTCAAGGCACCCGGGCTGTTCAAGAGAAAGAGACCAAAATCAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------><-------------------------------------------------------------------------------------
-D--F--P--R--F--Q--E--T--T--K--L--S--I--R--D--P--E--Q--G--L--E--G--S--L--E--Q--P--A--S--P--R--K--V--
GATTTTCCCAGGTTCCAAGAAACTACAAAACTCAGCATCAGAGATCCAGAGCAGGGTTTAGAAGGATCTCTAGAACAGCCTGCAAGCCCCAGGAAAGTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------
L--E--E--L--S--H--Q--S--P--E--N--L--V--S--L--A--*-
TGGAGGAGCTGTCTCATCAGTCACCAGAAAATCTCGTATCACTTGCTTAA
                                                  
--------------------------------------------------
--------------------------------------------------

Pig Consensus Sequence

>BGISUST0000889820
------------------------------------------------------ATGTTTCCCCCCAAATCCTCCTCAGACACAGAGACAGAAGAGCAGC
CGCCTGGGGATGGGCTGGTTTTGCCCAGAGCTGGCAGGCTCAGTGAGTTCCTCAGCCCAGAGGAGGAGACAGATTCTACTTCTGATTCAACGGGGAGCTT
TTATGAGACCCTGCAAGCGCTGAGGCAGAAAGGCAGGTGGTGCCTGTTGGAATCCCTTTATCCCTCTGACCCAGACAGTGATGGGAGCCTCTCTGAAGAT
GACGAGGACCTGGACAGTTTCTTCCAAGACAAAGGCAGGGGGAAGCCACAGGTGCAC------------------TGCGGCTCCAGAAGACGCTGCCACT
CCCTGAGCCACCTGCCCAGTGACACCCCCACGGCTCAGCCACCCTCTGGCTCCAGGCCTCCCTCCCAGCACAGAAGCATCAGCTCCTGGGCATCATCCAT
CACCGTCCCTCAGCCATTCCGCATGACGCTGCGAGAGGCCAGGAAGAAGGCCCAGTGGCTGGCCTCCCCTGCCTCTTTTGAGCACGAGAGGCAGCAGGCC
CAGAAGCAGGGCCAGGAGGAGGCCGAGTGCCACCGGCAGTTCCGGGCACAGCCCGTGCCTGCGCATGTCTACCTGCCCCTCTACCAGGAGATCGTGGAGC
GCAGCGAGGCGCGCAGGCGGGCAGGGATCCAGAAGAGGAAGGAACTGCTCCTCTCTTCCTTGAAGCCCTTCAGCTTCCTGGAGAAGGAGGAGCAGCGAAA
GAAAGCTGCTCAACAGAGGGACTTGGCCGCCGCAGCTAAGGTCAAAGTCCCCAAGCAGAAGGCCACCAAGAGGATCCCCAAGTCCATTCTGGAGCCCACC
CTCGGGGACAAACTC------GCTGAGCTCTTGAGGAAAATTCGCATCCAGATGAGAGCCCTGGACATGCTGCAGATGGCCTCCTCCCCCATCCCGTCCT
CCAGTAGCCGCCGGGCTGACCCACAGCTTCGCACAGCCACCCGGACCCGGAAGGAAAAGCTTGGGTTTCTGCAAACTGACTTTGGATTCCAGCCTCGGGT
GAATCCTGTCGTCCCTGACTATGAGGGCCTTTACAAGGCCTTCCAGAAAAGAGCCGCCAAGAGAAGGGACACGAGGGAGGTGACCCGCAACAAGCCCTTC
TTGCTGAGAACCGCCAGCCTGCGTCACACTTCACGGCCCTGTGATGTCGCTGCCTCTGAA----------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------AGGAAGTGTCAAGAGATATCGAAATCTGTGACTTTGCGTGCAAAA
GCCATGGATCCCCATAAAAGCCTGGAGGAAGTATTCAAAGCAAAGCTGAAAGAG------AACAATGACCGTAAAAGAGCAAAAGAGTATAAGAAAGAAC
TGGAGGAAATGAGaaGAATACAAATAAGGCCCTATCTCTTTGAACAAGTTACCAAG--------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------


>BGISUSP0000889820
------------------MFPPKSSSDTETEEQPPGDGLVLPRAGRLSEFLSPEEETDSTSDSTGSFYETLQALRQKGRWCLLESLYPSDPDSDGSLSED
DEDLDSFFQDKGRGKPQVH------CGSRRRCHSLSHLPSDTPTAQPPSGSRPPSQHRSISSWASSITVPQPFRMTLREARKKAQWLASPASFEHERQQA
QKQGQEEAECHRQFRAQPVPAHVYLPLYQEIVERSEARRRAGIQKRKELLLSSLKPFSFLEKEEQRKKAAQQRDLAAAAKVKVPKQKATKRIPKSILEPT
LGDKL--AELLRKIRIQMRALDMLQMASSPIPSSSSRRADPQLRTATRTRKEKLGFLQTDFGFQPRVNPVVPDYEGLYKAFQKRAAKRRDTREVTRNKPF
LLRTASLRHTSRPCDVAASE-----------------------------------------------------------------RKCQEISKSVTLRAK
AMDPHKSLEEVFKAKLKE--NNDRKRAKEYKKELEEMRRIQIRPYLFEQVTK------------------------------------------------
---------------------------------------------