Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000156150 (click for geneview)
Transcript ID ENST00000286667(link to ensembl)
Symbol ALX3
Localtion Chromosome:1:110315397:110325276:-1 band: 1p13.3
Description Homeobox protein aristaless-like 3 (Proline-rich transcription factor ALX3). [Source:Uniprot/SWISSPROT;Acc:O95076]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--D--P--E--H--C--A--P--F--R--V--G--P--A--P--G--P--Y--V--A--S--G--D--E--P--P--G--P--Q--G--T--P--A--
ATGGACCCCGAGCACTGCGCGCCTTTCCGCGTGGGGCCTGCACCCGGCCCCTATGTGGCCTCGGGGGACGAGCCTCCGGGCCCGCAGGGAACCCCCGCCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--A--P--H--L--H--P--A--P--P--R--G--P--R--L--T--R--F--P--A--C--G--P--L--E--P--Y--L--P--E--P--A--K--P
CTGCGCCTCACCTGCACCCCGCGCCGCCCCGCGGCCCGCGGCTGACCCGCTTTCCGGCCTGCGGGCCCCTGGAGCCCTACCTCCCAGAGCCGGCCAAGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------><----------------------
--P--A--K--Y--L--Q--D--L--G--P--G--P--A--L--N--G--G--H--F--Y--E--G--P--A--E--A--E--E--K--T--S--K--A-
GCCCGCCAAGTACCTGCAGGACCTCGGGCCCGGCCCGGCCCTCAACGGCGGCCACTTCTACGAGGGCCCCGCGGAAGCTGAGGAGAAGACCTCCAAAGCT
                                                                               ::.::::::.:::::::::::
-------------------------------------------------------------------------------GAAGAGAAGGCCTCCAAAGCT
--------------------------------------------------------------------------------E--E--K--A--S--K--A-

----------------------------------------------------------------------------------------------------
-A--S--F--P--Q--L--P--L--D--C--R--G--G--P--R--D--G--P--S--N--L--Q--G--S--P--G--P--C--L--A--S--L--H--
GCCAGCTTCCCCCAGCTGCCCTTGGACTGCCGAGGGGGCCCCAGAGACGGGCCCTCTAACTTGCAAGGCTCCCCAGGCCCCTGCCTGGCCAGCCTGCATC
:::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::: .::::::::::: :::::::::::::::::::.: 
GCCAGCTTCCCCCAGCTGCCCTTGGACTGCCGCGGGGGCCCCAGAGACGGGCCCTCTAACTTGCCGGGCTCCCCAGGGCCCTGCCTGGCCAGCCTGCGTG
-A--S--F--P--Q--L--P--L--D--C--R--G--G--P--R--D--G--P--S--N--L--P--G--S--P--G--P--C--L--A--S--L--R--

----------------------------------------------------------------------------------------------------
L--P--L--S--P--G--L--P--D--S--M--E--L--A--K--N--K--S--K--K--R--R--N--R--T--T--F--S--T--F--Q--L--E--E
TTCCTCTTTCCCCGGGACTCCCTGACTCCATGGAGTTGGCCAAGAACAAGAGCAAGAAGCGTCGTAACCGCACGACCTTCAGCACATTCCAGCTGGAGGA
:.::::: :: :: ::::: ::::::::::::::::::::::::                                                        
TCCCTCTGTC-CCCGGACT-CCTGACTCCATGGAGTTGGCCAAG--------------------------------------------------------
V--P--L--S--P--G--L--P--D--S--M--E--L--A--K---------------------------------------------------------

--------------------------------------------------------------------------------------------------->
--L--E--K--V--F--Q--K--T--H--Y--P--D--V--Y--A--R--E--Q--L--A--L--R--T--D--L--T--E--A--R--V--Q--V--W-
GCTGGAGAAGGTCTTCCAGAAAACCCACTATCCTGATGTGTATGCCCGGGAGCAGCTGGCCCTGCGCACAGACCTGACTGAGGCCCGGGTACAGGTCTGG
                                                                                              ::::::
----------------------------------------------------------------------------------------------GTCTGG
-----------------------------------------------------------------------------------------------V--W-

<---------------------------------------------------------------------------------------------------
-F--Q--N--R--R--A--K--W--R--K--R--E--R--Y--G--K--I--Q--E--G--R--N--P--F--T--A--A--Y--D--I--S--V--L--
TTCCAGAACCGCAGAGCCAAGTGGCGGAAGCGCGAGCGTTATGGGAAGATCCAGGAGGGGCGGAACCCCTTCACGGCTGCCTATGACATCTCTGTGCTGC
::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::: ::::::::::::::::.:::::::
TTTCAGAACCGCAGAGCCAAGTGGCGGAAGCGCGAGCGTTATGGGAAGATCCAGGAGGGACGGAACCCCTTCACGTCTGCCTATGACATCTCCGTGCTGC
-F--Q--N--R--R--A--K--W--R--K--R--E--R--Y--G--K--I--Q--E--G--R--N--P--F--T--S--A--Y--D--I--S--V--L--

----------------------------><----------------------------------------------------------------------
P--R--T--D--S--H--P--Q--L--Q--N--S--L--W--A--S--P--G--S--G--S--P--G--G--P--C--L--V--S--P--E--G--I--P
CCCGTACTGACAGCCACCCTCAGCTGCAGAACTCCCTGTGGGCCAGTCCAGGATCTGGGAGCCCTGGAGGCCCCTGCCTTGTGTCTCCAGAGGGCATCCC
:.:: ::.::::::::.::.:::                                       ::.::.:::::::::::.::::::::::::::::::::
CTCGAACCGACAGCCATCCCCAG---------------------------------------CCCGGGGGCCCCTGCCTCGTGTCTCCAGAGGGCATCCC
P--R--T--D--S--H--P--Q-----------------------------------------P--G--G--P--C--L--V--S--P--E--G--I--P

----------------------------------------------------------------------------------------------------
--S--P--C--M--S--P--Y--S--H--P--H--G--S--V--A--G--F--M--G--V--P--A--P--S--A--A--H--P--G--I--Y--S--I-
CTCCCCATGCATGTCTCCATATTCCCACCCCCATGGGAGTGTGGCTGGCTTCATGGGGGTGCCAGCCCCTTCTGCGGCTCACCCTGGCATCTACTCCATC
::::::.::::::::.:::::..:::::.: :::::::..:::::::::::::::::::::::.:::.::.:.: .::.: ::: .::::::::::::::
CTCCCCGTGCATGTCCCCATACCCCCACTCGCATGGGAACGTGGCTGGCTTCATGGGGGTGCCGGCCTCTCCCGGAGCCCCCCCGAGCATCTACTCCATC
--S--P--C--M--S--P--Y--P--H--S--H--G--N--V--A--G--F--M--G--V--P--A--S--P--G--A--P--P--S--I--Y--S--I-

----------------------------------------------------------------------------------------------------
-H--G--F--P--P--T--L--G--G--H--S--F--E--P--S--S--D--G--D--Y--K--S--P--S--L--V--S--L--R--V--K--P--K--
CATGGCTTTCCCCCCACCCTGGGGGGCCACAGCTTTGAGCCTTCCTCAGATGGTGACTATAAGTCTCCAAGCCTCGTCTCGCTCAGGGTAAAGCCCAAGG
::..:::::.::::..::::.:::: :::::::::::::::.:::.:::::::.:::::::::::::::::::::.::::.::::::::.::::::::::
CACAGCTTTTCCCCTGCCCTAGGGGCCCACAGCTTTGAGCCCTCCCCAGATGGCGACTATAAGTCTCCAAGCCTCATCTCACTCAGGGTGAAGCCCAAGG
-H--S--F--S--P--A--L--G--A--H--S--F--E--P--S--P--D--G--D--Y--K--S--P--S--L--I--S--L--R--V--K--P--K--

--------------------------------
E--P--P--G--L--L--N--W--T--T--*-
AGCCACCCGGCCTTCTGAACTGGACCACGTGA
::::.:::..::: ::::::::::::::::::
AGCCGCCCAACCTGCTGAACTGGACCACGTGA
E--P--P--N--L--L--N--W--T--T--*-

Pig Consensus Sequence

>BGISUST0000883959
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------GAAGAGAAGGCCTCCAAAGCT
GCCAGCTTCCCCCAGCTGCCCTTGGACTGCCGCGGGGGCCCCAGAGACGGGCCCTCTAACTTGCCGGGCTCCCCAGGGCCCTGCCTGGCCAGCCTGCGTG
TCCCTCTgcCCGGacCTGACTCCATGGAGTTGGCCAAG--------------------------------------------------------------
----------------------------------------------------------------------------------------GTCTGGTTTCAG
AACCGCAGAGCCAAGTGGCGGAAGCGCGAGCGTTATGGGAAGATCCAGGAGGGACGGAACCCCTTCACGTCTGCCTATGACATCTCCGTGCTGCCTCGAA
CCGACAGCCATCCCCAG---------------------------------------CCCGGGGGCCCCTGCCTCGTGTCTCCAGAGGGCATCCCCTCCCC
GTGCATGTCCCCATACCCCCACTCGCATGGGAACGTGGCTGGCTTCATGGGGGTGCCGGCCTCTCCCGGAGCCCCCCCGAGCATCTACTCCATCCACAGC
TTTTCCCCTGCCCTAGGGGCCCACAGCTTTGAGCCCTCCCCAGATGGCGACTATAAGTCTCCAAGCCTCATCTCACTCAGGGTGAAGCCCAAGGAGCCGC
CCAACCTGCTGAACTGGACCACGTGA


>BGISUSP0000883959
---------------------------------------------------------------------------------------------EEKASKA
ASFPQLPLDCRGGPRDGPSNLPGSPGPCLASLRVPLPGPDSMELAK--------------------------------------------------VWFQ
NRRAKWRKRERYGKIQEGRNPFTSAYDISVLPRTDSHPQ-------------PGGPCLVSPEGIPSPCMSPYPHSHGNVAGFMGVPASPGAPPSIYSIHS
FSPALGAHSFEPSPDGDYKSPSLISLRVKPKEPPNLLNWTT*