Sequences
EST Library Info
pigcb1Unavailable
pliv2Unavailable
sin5Small intestine
tra1Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000156171 (click for geneview)
Transcript ID ENST00000286692(link to ensembl)
Symbol NP_848549.2
Localtion Chromosome:1:111372343:111394704:-1 band: 1p13.3
Description hypothetical protein MGC54289
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----------------------><--------------------------------------------------------------------------
-M--L--N--I--A--A--V--L--C--I--A--T--I--Y--V--R--Y--K--Q--V--H--A--L--S--P--E--E--N--V--I--I--K--L--
ATGCTAAATATTGCGGCAGTTTTATGCATTGCTACCATTTATGTTCGTTATAAGCAAGTTCATGCTCTGAGTCCTGAAGAGAACGTTATCATCAAATTAA
                           .:::: :::::::::::::::::::::::::::::::::::::.::::::::::::.  ::::::::.:::::
---------------------------GTTGCAACCATTTATGTTCGTTATAAGCAAGTTCATGCTCTGAATCCTGAAGAGAATTGTATCATCAGATTAA
----------------------------V--A--T--I--Y--V--R--Y--K--Q--V--H--A--L--N--P--E--E--N--C--I--I--R--L--

----------------------------------------------------------------><----------------------------------
N--K--A--G--L--V--L--G--I--L--S--C--L--G--L--S--I--V--A--N--F--Q--K--T--T--L--F--A--A--H--V--S--G--A
ACAAGGCTGGCCTTGTACTTGGAATACTGAGTTGTTTAGGACTTTCTATTGTGGCAAACTTCCAGAAAACAACCCTTTTTGCTGCACATGTAAGTGGAGC
::::::::::::::::::::::: :::::::::::::::::::::::.::::::::::::::::::::::::::.:::::::::.::::::. :::::::
ACAAGGCTGGCCTTGTACTTGGATTACTGAGTTGTTTAGGACTTTCTGTTGTGGCAAACTTCCAGAAAACAACCTTTTTTGCTGTACATGTGTGTGGAGC
N--K--A--G--L--V--L--G--L--L--S--C--L--G--L--S--V--V--A--N--F--Q--K--T--T--F--F--A--V--H--V--C--G--A

----------------------------------------------------------------------------------------------------
--V--L--T--F--G--M--G--S--L--Y--M--F--V--Q--T--I--L--S--Y--Q--M--Q--P--K--I--H--G--K--Q--V--F--W--I-
TGTGCTTACCTTTGGTATGGGCTCATTATATATGTTTGTTCAGACCATCCTTTCCTACCAAATGCAGCCCAAAATCCATGGCAAACAAGTCTTCTGGATC
:.:.::.::::::::.:::::::::::::::::::::::::::::.::::::::::::::::::::::::::.::.::::::::::::::::::::::::
TATACTCACCTTTGGCATGGGCTCATTATATATGTTTGTTCAGACTATCCTTTCCTACCAAATGCAGCCCAAGATTCATGGCAAACAAGTCTTCTGGATC
--I--L--T--F--G--M--G--S--L--Y--M--F--V--Q--T--I--L--S--Y--Q--M--Q--P--K--I--H--G--K--Q--V--F--W--I-

------------------------------------------><--------------------------------------------------------
-R--L--L--L--V--I--W--C--G--V--S--A--L--S--M--L--T--C--S--S--V--L--H--S--G--N--F--G--T--D--L--E--Q--
AGACTGTTGTTGGTTATCTGGTGTGGAGTAAGTGCACTTAGCATGCTGACTTGCTCATCAGTTTTGCACAGTGGCAATTTTGGGACTGATTTAGAACAGA
:::::..:::::::::::::::::::::::::::::         ::::::::::::::: :::::.:::::.:::.:::::: :::::: ::: :::::
AGACTACTGTTGGTTATCTGGTGTGGAGTAAGTGCA---------CTGACTTGCTCATCACTTTTGTACAGTAGCAGTTTTGGCACTGATATAGTACAGA
-R--L--L--L--V--I--W--C--G--V--S--A-----------L--T--C--S--S--L--L--Y--S--S--S--F--G--T--D--I--V--Q--

-------------------------><-------------------------------------------------------------------------
K--L--H--W--N--P--E--D--K--G--Y--V--L--H--M--I--T--T--A--A--E--W--S--M--S--F--S--F--F--G--F--F--L--T
AACTCCATTGGAACCCCGAGGACAAAGGTTATGTGCTTCACATGATCACTACTGCAGCAGAATGGTCTATGTCATTTTCCTTCTTTGGTTTTTTCCTGAC
:::::::::::::::: ::::::::::::::::.::::::.:::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::
AACTCCATTGGAACCCGGAGGACAAAGGTTATGCGCTTCATATGATCACTGCTGCAGCAGAATGGTCTATGTCATTTTCCTTCTTTGGTTTTTTCCTGAC
K--L--H--W--N--P--E--D--K--G--Y--A--L--H--M--I--T--A--A--A--E--W--S--M--S--F--S--F--F--G--F--F--L--T

------------------><--------------------------------------------------------------------------------
--Y--I--R--D--F--Q--K--I--S--L--R--V--E--A--N--L--H--G--L--T--L--Y--D--T--A--P--C--P--I--N--N--E--R-
TTACATTCGTGATTTTCAGAAAATTTCTTTACGGGTGGAAGCCAATTTACATGGATTAACCCTCTATGACACTGCACCTTGCCCTATTAACAATGAACGA
:::.::.::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::.::::: :::::::::.::::::::::::::
TTATATCCGTGATTTTCAGAAAATTTCTTTACGGGTGGAAGCCAATTTACATGGATTAACGCTCTATGATACTGCTCCTTGCCCTGTTAACAATGAACGA
--Y--I--R--D--F--Q--K--I--S--L--R--V--E--A--N--L--H--G--L--T--L--Y--D--T--A--P--C--P--V--N--N--E--R-

-------------------------->
-T--R--L--L--S--R--D--I--*-
ACACGGCTACTTTCCAGAGATATTTGA
::: ::::::::::::::::::: :::
ACAAGGCTACTTTCCAGAGATATATGA
-T--R--L--L--S--R--D--I--*-

Pig Consensus Sequence

>BGISUST0000900536
---------------------------GTTGCAACCATTTATGTTCGTTATAAGCAAGTTCATGCTCTGAATCCTGAAGAGAATTGTATCATCAGATTAA
ACAAGGCTGGCCTTGTACTTGGATTACTGAGTTGTTTAGGACTTTCTGTTGTGGCAAACTTCCAGAAAACAACCTTTTTTGCTGTACATGTGTGTGGAGC
TATACTCACCTTTGGCATGGGCTCATTATATATGTTTGTTCAGACTATCCTTTCCTACCAAATGCAGCCCAAGATTCATGGCAAACAAGTCTTCTGGATC
AGACTACTGTTGGTTATCTGGTGTGGAGTAAGTGCA---------CTGACTTGCTCATCACTTTTGTACAGTAGCAGTTTTGGCACTGATATAGTACAGA
AACTCCATTGGAACCCGGAGGACAAAGGTTATGCGCTTCATATGATCACTGCTGCAGCAGAATGGTCTATGTCATTTTCCTTCTTTGGTTTTTTCCTGAC
TTATATCCGTGATTTTCAGAAAATTTCTTTACGGGTGGAAGCCAATTTACATGGATTAACGCTCTATGATACTGCTCCTTGCCCTGTTAACAATGAACGA
ACAAGGCTACTTTCCAGAGATATATGA


>BGISUSP0000900536
---------VATIYVRYKQVHALNPEENCIIRLNKAGLVLGLLSCLGLSVVANFQKTTFFAVHVCGAILTFGMGSLYMFVQTILSYQMQPKIHGKQVFWI
RLLLVIWCGVSA---LTCSSLLYSSSFGTDIVQKLHWNPEDKGYALHMITAAAEWSMSFSFFGFFLTYIRDFQKISLRVEANLHGLTLYDTAPCPVNNER
TRLLSRDI*