Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000156853 (click for geneview)
Transcript ID ENST00000287461(link to ensembl)
Symbol NP_612456.1
Localtion Chromosome:16:30522203:30529183:-1 band: 16p11.2
Description hypothetical protein BC014000
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--P--P--S--A--P--L--P--A--Q--G--P--G--K--A--R--P--S--R--K--R--G--R--R--P--R--A--L--K--F--V--D--
ATGGCGCCACCTTCGGCTCCGCTCCCTGCGCAGGGACCAGGAAAGGCCAGACCCAGTCGGAAAAGGGGCAGGAGGCCGAGGGCTCTGAAGTTCGTGGACG
::::::: . :::: :::::::::::.::::.:::: :.:::.:::::.:::::.:.:::: :: ::: : ::::::.: :::. :::::::::.:::::
ATGGCGCGGACTTCCGCTCCGCTCCCCGCGCGGGGAGCGGGAGAGGCCGGACCCGGCCGGACAATGGGAACGAGGCCAATGGCCGTGAAGTTCGCGGACG
-M--A--R--T--S--A--P--L--P--A--R--G--A--G--E--A--G--P--G--R--T--M--G--T--R--P--M--A--V--K--F--A--D--

----------------------------------------------------------------------------------------------------
V--A--V--Y--F--S--P--E--E--W--G--C--L--R--P--A--Q--R--A--L--Y--R--D--V--M--R--E--T--Y--G--H--L--G--A
TGGCCGTGTACTTCTCCCCGGAGGAGTGGGGCTGCCTGCGGCCCGCGCAGAGGGCCCTGTACCGGGACGTGATGCGGGAGACCTACGGTCACCTGGGCGC
 ::::::::::::::::::::: :::::::: ::.:::::::::::::::::::::::::::::::::::::::: ::::::::::.:.::::::::: :
AGGCCGTGTACTTCTCCCCGGACGAGTGGGGGTGTCTGCGGCCCGCGCAGAGGGCCCTGTACCGGGACGTGATGCTGGAGACCTACAGCCACCTGGGCTC
E--A--V--Y--F--S--P--D--E--W--G--C--L--R--P--A--Q--R--A--L--Y--R--D--V--M--L--E--T--Y--S--H--L--G--S

----><----------------------------------------------------------------------------------------------
--L--G--C--A--G--P--K--P--A--L--I--S--W--L--E--R--N--T--D--D--W--E--P--A--A--L--D--P--Q--E--Y--P--R-
GCTCGGGTGCGCAGGTCCCAAACCAGCCCTCATCTCCTGGTTGGAACGAAACACCGATGACTGGGAACCGGCTGCTCTAGATCCGCAGGAGTACCCGAGA
::::   :::::::::::::::::: :::::::::::::::::::::::::.::::::::.::::::::::::::.::.:::::.:::::::.:::.::.
GCTC---TGCGCAGGTCCCAAACCATCCCTCATCTCCTGGTTGGAACGAAATACCGATGATTGGGAACCGGCTGCCCTGGATCCACAGGAGTGCCCAAGG
--L-----C--A--G--P--K--P--S--L--I--S--W--L--E--R--N--T--D--D--W--E--P--A--A--L--D--P--Q--E--C--P--R-

------------------><--------------------------------------------------------------------------------
-G--L--T--V--Q--R--K--S--R--T--R--K--K--N--G--E--K--E--V--F--P--P--K--E--A--P--R--K--G--K--R--G--R--
GGGCTAACAGTCCAGAGAAAAAGCAGAACCAGAAAGAAGAATGGGGAGAAGGAAGTATTCCCGCCTAAGGAGGCACCCCGAAAGGGGAAGCGAGGCCGGA
::: ::::::::::::::                                                                                  
GGGGTAACAGTCCAGAGA----------------------------------------------------------------------------------
-G--V--T--V--Q--R-----------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--P--S--K--P--R--L--I--P--R--Q--T--S--G--G--P--I--C--P--D--C--G--C--T--F--P--D--H--Q--A--L--E--S--H
GGCCCAGCAAACCCCGACTGATTCCTAGGCAGACGTCCGGGGGCCCCATCTGCCCTGACTGCGGCTGTACCTTCCCTGATCATCAGGCCCTGGAGAGCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--C--A--Q--N--L--K--K--P--Y--P--C--P--D--C--G--R--R--F--S--Y--P--S--L--L--V--S--H--R--R--A--H--S-
CAAGTGCGCCCAGAATCTAAAAAAGCCTTACCCTTGCCCAGACTGTGGGCGCCGCTTTTCCTATCCATCCCTGCTGGTCAGTCACCGGCGGGCACACTCC
          :::::.::.:::::::::::::::::.::::::::.:::::::::::::::::.::.::::::::::::::::::::::::::.:::::.
----------CAGAACCTGAAAAAGCCTTACCCTTGTCCAGACTGCGGGCGCCGCTTTTCCTACCCGTCCCTGCTGGTCAGTCACCGGCGGGCGCACTCT
-----------Q--N--L--K--K--P--Y--P--C--P--D--C--G--R--R--F--S--Y--P--S--L--L--V--S--H--R--R--A--H--S-

----------------------------------------------------------------------------------------------------
-G--E--C--P--Y--V--C--D--Q--C--G--K--R--F--S--Q--R--K--N--L--S--Q--H--Q--V--I--H--T--G--E--K--P--Y--
GGCGAGTGCCCCTATGTTTGTGACCAGTGTGGCAAACGTTTCTCCCAGCGCAAGAACCTCTCCCAGCACCAGGTCATCCATACAGGGGAGAAGCCCTATC
:: :::::.::::::::.::.::::::::::::::.::.::::::::::::::::::::::::::::::::::: :::::.:: :: :::::::::::.:
GGGGAGTGTCCCTATGTCTGCGACCAGTGTGGCAAGCGCTTCTCCCAGCGCAAGAACCTCTCCCAGCACCAGGTGATCCACACCGGCGAGAAGCCCTACC
-G--E--C--P--Y--V--C--D--Q--C--G--K--R--F--S--Q--R--K--N--L--S--Q--H--Q--V--I--H--T--G--E--K--P--Y--

----------------------------------------------------------------------------------------------------
H--C--P--D--C--G--R--C--F--R--R--S--R--S--L--A--N--H--R--T--T--H--T--G--E--K--P--H--Q--C--P--S--C--G
ACTGCCCTGACTGTGGTCGCTGCTTCCGGAGGAGCCGGTCCTTGGCCAATCACCGGACCACACACACAGGTGAAAAACCCCACCAGTGCCCTAGCTGTGG
::::::::::::::::.::::::::::::::::::::::::.:::::::::::::::::::.:::::.::::::::::: ::::::::::: :::::.::
ACTGCCCTGACTGTGGCCGCTGCTTCCGGAGGAGCCGGTCCCTGGCCAATCACCGGACCACGCACACGGGTGAAAAACCGCACCAGTGCCCGAGCTGCGG
H--C--P--D--C--G--R--C--F--R--R--S--R--S--L--A--N--H--R--T--T--H--T--G--E--K--P--H--Q--C--P--S--C--G

----------------------------------------------------------------------------------------------------
--R--R--F--A--Y--P--S--L--L--A--I--H--Q--R--T--H--T--G--E--K--P--Y--T--C--L--E--C--N--R--R--F--R--Q-
ACGTCGCTTCGCCTACCCCTCCCTGCTAGCCATCCACCAGCGTACACACACGGGAGAGAAGCCCTACACTTGCCTCGAGTGCAACCGCCGCTTCCGCCAG
.:: :::::::::::::::::::::::.:::::.::::::::.::.:::::::: ::::::::::::::.::::: :::::::.::: ::::::::::::
GCGGCGCTTCGCCTACCCCTCCCTGCTGGCCATTCACCAGCGCACGCACACGGGCGAGAAGCCCTACACCTGCCTGGAGTGCAGCCGGCGCTTCCGCCAG
--R--R--F--A--Y--P--S--L--L--A--I--H--Q--R--T--H--T--G--E--K--P--Y--T--C--L--E--C--S--R--R--F--R--Q-

----------------------------------------------------------------------------------------------------
-R--T--A--L--V--I--H--Q--R--I--H--T--G--E--K--P--Y--P--C--P--D--C--E--R--R--F--S--S--S--S--R--L--V--
CGCACGGCCCTCGTCATCCACCAGCGCATCCACACGGGCGAGAAGCCCTACCCGTGCCCGGACTGCGAGCGGCGCTTCTCCTCCTCCTCTCGCCTGGTCA
:::::::: :::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::: ::.:::::::: :::::.::::::::::
CGCACGGCGCTCGTCATCCACCAGCGCATCCACACCGGCGAGAAGCCCTACCCGTGCCCGGACTGCGAGCGCCGTTTCTCCTCGTCCTCCCGCCTGGTCA
-R--T--A--L--V--I--H--Q--R--I--H--T--G--E--K--P--Y--P--C--P--D--C--E--R--R--F--S--S--S--S--R--L--V--

----------------------------------------------------------------------------------------------------
S--H--R--R--V--H--S--G--E--R--P--Y--A--C--E--H--C--E--A--R--F--S--Q--R--S--T--L--L--Q--H--Q--L--L--H
GTCACCGGCGTGTGCACTCTGGGGAGCGTCCCTATGCCTGCGAGCACTGTGAGGCCCGCTTCTCCCAGCGCAGCACGCTGCTCCAGCACCAGCTCTTGCA
:::::::::: ::::::::.:::::::: :::::.::::::::::::::.:::::::::::::: ::::::::::::::::::::::::::::: .::::
GTCACCGGCGGGTGCACTCCGGGGAGCGGCCCTACGCCTGCGAGCACTGCGAGGCCCGCTTCTCGCAGCGCAGCACGCTGCTCCAGCACCAGCTGCTGCA
S--H--R--R--V--H--S--G--E--R--P--Y--A--C--E--H--C--E--A--R--F--S--Q--R--S--T--L--L--Q--H--Q--L--L--H

----------------------------------------------------------------------------------------------------
--T--G--E--K--P--Y--P--C--P--D--C--G--R--A--F--R--R--S--G--S--L--A--I--H--R--S--T--H--T--E--E--K--L-
CACCGGAGAGAAGCCCTACCCCTGCCCAGACTGTGGGCGTGCCTTCCGGCGGAGCGGCTCCCTGGCCATCCATCGCAGCACGCACACAGAGGAGAAGCTG
::: :: ::::::::::: :: :::::.:::::.:: ::.::::::::::::                                                
CACGGGCGAGAAGCCCTAACCGTGCCCGGACTGCGGCCGCGCCTTCCGGCGG------------------------------------------------
--T--G--E--K--P--*--P--C--P--D--C--G--R--A--F--R--R-------------------------------------------------

----------------------------------------------------------------------------------------------------
-H--A--C--D--D--C--G--R--R--F--A--Y--P--S--L--L--A--S--H--R--R--V--H--S--G--E--R--P--Y--A--C--D--L--
CACGCCTGCGACGACTGTGGTCGCCGCTTTGCCTACCCCTCACTGCTGGCCAGCCACCGGCGCGTGCACTCGGGCGAGCGGCCCTATGCCTGCGACCTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
C--S--K--R--F--A--Q--W--S--H--L--A--Q--H--Q--L--L--H--T--G--E--K--P--F--P--C--L--E--C--G--R--C--F--R
GCTCCAAGCGTTTTGCTCAGTGGAGCCACCTGGCCCAGCACCAGCTGCTGCACACGGGGGAGAAGCCTTTCCCCTGCCTCGAGTGTGGCCGGTGCTTCCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--R--W--S--L--A--V--H--K--C--S--P--K--A--P--N--C--S--P--R--S--A--I--G--G--S--S--Q--R--G--N--A--H-
CCAGAGGTGGTCTCTGGCTGTCCACAAGTGTAGCCCCAAGGCCCCAAACTGTAGCCCTAGATCTGCTATCGGGGGCTCCAGTCAGAGGGGCAACGCCCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-->
-*-
TAG
   
---
---

Pig Consensus Sequence

>BGISUST0000900751
ATGGCGCGGACTTCCGCTCCGCTCCCCGCGCGGGGAGCGGGAGAGGCCGGACCCGGCCGGACAATGGGAACGAGGCCAATGGCCGTGAAGTTCGCGGACG
AGGCCGTGTACTTCTCCCCGGACGAGTGGGGGTGTCTGCGGCCCGCGCAGAGGGCCCTGTACCGGGACGTGATGCTGGAGACCTACAGCCACCTGGGCTC
GCTC---TGCGCAGGTCCCAAACCATCCCTCATCTCCTGGTTGGAACGAAATACCGATGATTGGGAACCGGCTGCCCTGGATCCACAGGAGTGCCCAAGG
GGGGTAACAGTCCAGAGA----------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------CAGAACCTGAAAAAGCCTTACCCTTGTCCAGACTGCGGGCGCCGCTTTTCCTACCCGTCCCTGCTGGTCAGTCACCGGCGGGCGCACTCT
GGGGAGTGTCCCTATGTCTGCGACCAGTGTGGCAAGCGCTTCTCCCAGCGCAAGAACCTCTCCCAGCACCAGGTGATCCACACCGGCGAGAAGCCCTACC
ACTGCCCTGACTGTGGCCGCTGCTTCCGGAGGAGCCGGTCCCTGGCCAATCACCGGACCACGCACACGGGTGAAAAACCGCACCAGTGCCCGAGCTGCGG
GCGGCGCTTCGCCTACCCCTCCCTGCTGGCCATTCACCAGCGCACGCACACGGGCGAGAAGCCCTACACCTGCCTGGAGTGCAGCCGGCGCTTCCGCCAG
CGCACGGCGCTCGTCATCCACCAGCGCATCCACACCGGCGAGAAGCCCTACCCGTGCCCGGACTGCGAGCGCCGTTTCTCCTCGTCCTCCCGCCTGGTCA
GTCACCGGCGGGTGCACTCCGGGGAGCGGCCCTACGCCTGCGAGCACTGCGAGGCCCGCTTCTCGCAGCGCAGCACGCTGCTCCAGCACCAGCTGCTGCA
CACGGGCGAGAAGCCCTAACCGTGCCCGGACTGCGGCCGCGCCTTCCGGCGG------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---


>BGISUSP0000900751
MARTSAPLPARGAGEAGPGRTMGTRPMAVKFADEAVYFSPDEWGCLRPAQRALYRDVMLETYSHLGSL-CAGPKPSLISWLERNTDDWEPAALDPQECPR
GVTVQR----------------------------------------------------------------QNLKKPYPCPDCGRRFSYPSLLVSHRRAHS
GECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGRCFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYTCLECSRRFRQ
RTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHCEARFSQRSTLLQHQLLHTGEKP*PCPDCGRAFRR----------------
----------------------------------------------------------------------------------------------------
-