Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000157093 (click for geneview)
Transcript ID ENST00000287748(link to ensembl)
Symbol LYZL4
Localtion Chromosome:3:42413581:42427069:-1 band: 3p22.1
Description lysozyme-like 4 [Source:RefSeq_peptide;Acc:NP_653235]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--K--A--S--V--V--L--S--L--L--G--Y--L--V--V--P--S--G--A--Y--I--L--G--R--C--T--V--A--K--K--L--H--D--
ATGAAGGCATCCGTGGTTCTCTCCCTCCTTGGCTACCTGGTGGTTCCAAGTGGTGCTTACATCTTGGGGCGTTGCACAGTGGCTAAGAAACTCCACGATG
::::::::.::.::::: ::::::::: :::: :::.::::::::::::::::::::  ..::::::::::.::... :::::.:::::.:::::::: :
ATGAAGGCGTCTGTGGTGCTCTCCCTCATTGGGTACTTGGTGGTTCCAAGTGGTGCTGCTGTCTTGGGGCGCTGTGTCGTGGCCAAGAAGCTCCACGAAG
-M--K--A--S--V--V--L--S--L--I--G--Y--L--V--V--P--S--G--A--A--V--L--G--R--C--V--V--A--K--K--L--H--E--

--------------------------------------><------------------------------------------------------------
G--G--L--D--Y--F--E--G--Y--S--L--E--N--W--V--C--L--A--Y--F--E--S--K--F--N--P--M--A--I--Y--E--N--T--R
GAGGCCTGGATTATTTTGAGGGCTATAGCCTTGAGAACTGGGTGTGCCTGGCCTACTTCGAGAGCAAGTTCAACCCCATGGCCATCTACGAGAACACACG
::::::::..: :.: :::::: ::.::::::::.:::   :::::::::::.::.::.:::::::::::::::::::.::::.::::.:: ::: . ::
GAGGCCTGAGTGACTATGAGGGATACAGCCTTGAAAAC---GTGTGCCTGGCTTATTTTGAGAGCAAGTTCAACCCCACGGCCGTCTATGATAACCTTCG
G--G--L--S--D--Y--E--G--Y--S--L--E--N-----V--C--L--A--Y--F--E--S--K--F--N--P--T--A--V--Y--D--N--L--R

-------------------------------------------------------------------------------------------><-------
--E--G--Y--T--G--F--G--L--F--Q--M--R--G--S--D--W--C--G--D--H--G--R--N--R--C--H--M--S--C--S--A--L--L-
TGAGGGCTACACTGGCTTTGGCCTCTTTCAGATGCGTGGCAGTGACTGGTGTGGCGACCATGGCAGGAACCGCTGCCATATGTCATGTTCCGCTTTACTG
::. :.::::::.:::: ::::::::::::::: ::.... .::::::::::   ::::::::::.:::::::::::::.:::: ::.      ::::::
TGGTGACTACACCGGCTATGGCCTCTTTCAGATCCGCAATCATGACTGGTGT---GACCATGGCAAGAACCGCTGCCATGTGTCCTGC------TTACTG
--G--D--Y--T--G--Y--G--L--F--Q--I--R--N--H--D--W--C-----D--H--G--K--N--R--C--H--V--S--C--------L--L-

----------------------------------------------------------------------><----------------------------
-N--P--N--L--E--K--T--I--K--C--A--K--T--I--V--K--G--K--E--G--M--G--A--W--P--T--W--S--R--Y--C--Q--Y--
AATCCTAATTTAGAGAAGACAATTAAATGTGCCAAGACCATTGTAAAAGGAAAAGAAGGGATGGGAGCATGGCCCACCTGGTCCCGGTACTGCCAGTACT
::::: ::::::.::.::::::::::.::::::::::  :::::: ::::::::..:::::::::::::                               
AATCCGAATTTAAAGGAGACAATTAAGTGTGCCAAGAAAATTGTACAAGGAAAAAGAGGGATGGGAGCA-------------------------------
-N--P--N--L--K--E--T--I--K--C--A--K--K--I--V--Q--G--K--R--G--M--G--A--------------------------------

---------------------------------------->
S--D--T--L--A--R--W--L--D--G--C--K--L--*-
CCGATACCCTGGCACGGTGGCTGGATGGTTGCAAGCTGTAG
                                         
-----------------------------------------
-----------------------------------------

Pig Consensus Sequence

>BGISUST0000889090
ATGAAGGCGTCTGTGGTGCTCTCCCTCATTGGGTACTTGGTGGTTCCAAGTGGTGCTGCTGTCTTGGGGCGCTGTGTCGTGGCCAAGAAGCTCCACGAAG
GAGGCCTGAGTGACTATGAGGGATACAGCCTTGAAAAC---GTGTGCCTGGCTTATTTTGAGAGCAAGTTCAACCCCACGGCCGTCTATGATAACCTTCG
TGGTGACTACACCGGCTATGGCCTCTTTCAGATCCGCAATCATGACTGGTGTGACCATGGCAAGAACCGCTGCCATGTGTCCTGC------TTACTGAAT
CCGAATTTAAAGGAGACAATTAAGTGTGCCAAGAAAATTGTACAAGGAAAAAGAGGGATGGGAGCA----------------------------------
--------------------------------------


>BGISUSP0000889090
MKASVVLSLIGYLVVPSGAAVLGRCVVAKKLHEGGLSDYEGYSLEN-VCLAYFESKFNPTAVYDNLRGDYTGYGLFQIRNHDWCDHGKNRCHVSC--LLN
PNLKETIKCAKKIVQGKRGMGA------------------------