Sequences
EST Library Info
nms4Newborn 115 days, M. semitendinosus
pldo3Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000157119 (click for geneview)
Transcript ID ENST00000287777(link to ensembl)
Symbol KBTBD5
Localtion Chromosome:3:42702015:42708942:1 band: 3p22.1
Description kelch repeat and BTB (POZ) domain containing 5 [Source:RefSeq_peptide;Acc:NP_689606]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--L--G--L--E--Q--A--E--E--Q--R--L--Y--Q--Q--T--L--L--Q--D--G--L--K--D--M--L--D--H--G--K--F--L--
ATGGCGCTGGGCTTGGAGCAGGCGGAGGAGCAGCGGTTGTACCAGCAGACGCTCCTGCAAGACGGGCTCAAAGACATGCTGGACCATGGCAAGTTCCTCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--C--V--V--R--A--G--E--R--E--F--P--C--H--R--L--V--L--A--A--C--S--P--Y--F--R--A--R--F--L--A--E--P--E
ACTGTGTGGTGCGGGCGGGCGAGCGCGAGTTCCCGTGCCATCGCCTGGTGCTGGCCGCCTGCAGCCCCTACTTCCGGGCGCGCTTTCTAGCCGAGCCGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--R--A--G--E--L--H--L--E--E--V--S--P--D--V--V--A--Q--V--L--H--Y--L--Y--T--S--E--I--A--L--D--E--A--S-
GCGCGCGGGCGAGCTGCACCTGGAGGAGGTGTCCCCGGACGTGGTGGCCCAGGTGCTGCACTACCTGTACACATCAGAGATCGCGCTGGATGAGGCGAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-V--Q--D--L--F--A--A--A--H--R--F--Q--I--P--S--I--F--T--I--C--V--S--F--L--Q--K--R--L--C--L--S--N--C--
GTGCAGGATTTGTTCGCCGCGGCACACCGCTTCCAGATCCCTTCCATCTTCACCATCTGCGTGTCCTTCCTGCAGAAGCGCCTGTGCCTCTCCAACTGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--A--V--F--R--L--G--L--L--L--D--C--A--R--L--A--V--A--A--R--D--F--I--C--A--H--F--T--L--V--A--R--D--A
TGGCCGTCTTCCGTCTCGGCCTCCTGCTCGACTGCGCGCGTCTCGCCGTGGCTGCCCGCGACTTCATCTGCGCTCACTTCACGCTGGTGGCGCGCGACGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--D--F--L--G--L--S--A--D--E--L--I--A--I--I--S--S--D--G--L--N--V--E--K--E--E--A--V--F--E--A--V--M--R-
TGACTTCCTCGGACTCTCGGCCGACGAGCTCATCGCCATCATCTCCAGCGACGGCCTTAACGTGGAGAAGGAGGAGGCAGTGTTCGAGGCGGTGATGCGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-W--A--G--S--G--D--A--E--A--Q--A--E--R--Q--R--A--L--P--T--V--F--E--S--V--R--C--R--L--L--P--R--A--F--
TGGGCGGGTAGCGGCGACGCCGAGGCGCAGGCTGAGCGCCAGCGCGCGCTGCCCACCGTCTTCGAGAGCGTGCGCTGCCGCTTGCTGCCGCGCGCCTTTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--E--S--R--V--E--R--H--P--L--V--R--A--Q--P--E--L--L--R--K--V--Q--M--V--K--D--A--H--E--G--R--I--T--T
TGGAAAGCCGCGTGGAGCGCCACCCTCTCGTGCGTGCCCAGCCCGAGTTGCTGCGCAAGGTGCAGATGGTGAAGGATGCACACGAGGGCCGCATCACCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--R--K--K--K--K--G--K--D--G--A--G--A--K--E--A--D--K--G--T--S--K--A--K--A--E--E--D--E--E--A--E--R-
GCTGCGGAAGAAAAAGAAGGGGAAGGATGGAGCCGGGGCCAAGGAGGCTGATAAGGGCACAAGCAAAGCCAAAGCAGAGGAGGATGAGGAGGCCGAACGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-I--L--P--G--I--L--N--D--T--L--R--F--G--M--F--L--Q--D--L--I--F--M--I--S--E--E--G--A--V--A--Y--D--P--
ATCCTTCCTGGGATCCTCAATGACACCCTGCGCTTCGGCATGTTCCTGCAGGATCTCATCTTCATGATCAGTGAGGAGGGCGCTGTGGCCTACGATCCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--A--N--E--C--Y--C--A--S--L--S--N--Q--V--P--K--N--H--V--S--L--V--T--K--E--N--Q--V--F--V--A--G--G--L
CAGCCAACGAGTGCTACTGTGCTTCCCTCTCCAACCAGGTCCCCAAGAACCACGTCAGCCTGGTTACCAAGGAGAACCAGGTCTTCGTGGCTGGAGGCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------><-----------------------------------------------
--F--Y--N--E--D--N--K--E--D--P--M--S--A--Y--F--L--Q--F--D--H--L--D--S--E--W--L--G--M--P--P--L--P--S-
CTTCTACAACGAAGACAACAAAGAGGACCCCATGAGCGCATACTTCCTGCAGTTTGACCATCTGGACTCAGAGTGGCTGGGGATGCCACCGCTGCCCTCG
                                                                   ::: :::::::::: :::::.:: ::::: :::
-------------------------------------------------------------------TCATAGTGGCTGGGTATGCCGCCTCTGCCATCG
--------------------------------------------------------------------S--*--W--L--G--M--P--P--L--P--S-

----------------------------------------------------------------------------------------------------
-P--R--C--L--F--G--L--G--E--A--L--N--S--I--Y--V--V--G--G--R--E--I--K--D--G--E--R--C--L--D--S--V--M--
CCCCGCTGCCTCTTTGGCCTGGGAGAAGCTCTCAACTCCATCTACGTGGTCGGTGGCAGAGAGATCAAGGACGGCGAGCGCTGCCTGGACTCGGTCATGT
:: ::.::::::::.:::::::::::.::::::::::::::.:::::::::::.::: ::::: ::::::::::::::::: ::::::::::::::::::
CCGCGTTGCCTCTTCGGCCTGGGAGAGGCTCTCAACTCCATTTACGTGGTCGGCGGCCGAGAGCTCAAGGACGGCGAGCGCAGCCTGGACTCGGTCATGT
-P--R--C--L--F--G--L--G--E--A--L--N--S--I--Y--V--V--G--G--R--E--L--K--D--G--E--R--S--L--D--S--V--M--

------------><--------------------------------------------------------------------------------------
C--Y--D--R--L--S--F--K--W--G--E--S--D--P--L--P--Y--V--V--Y--G--H--T--V--L--S--H--M--D--L--V--Y--V--I
GCTACGACAGGCTGTCATTCAAATGGGGTGAATCGGACCCGCTGCCTTACGTGGTGTATGGCCACACAGTGCTCTCCCACATGGACCTTGTCTACGTAAT
:::::::::::   ::::::::::::::.:::::.::::::::::::::.:. ::::::::::::.:.:::::::::.::::::::::::::::.:: ::
GCTACGACAGG---TCATTCAAATGGGGCGAATCAGACCCGCTGCCTTATGCCGTGTATGGCCACGCGGTGCTCTCCTACATGGACCTTGTCTATGTCAT
C--Y--D--R-----S--F--K--W--G--E--S--D--P--L--P--Y--A--V--Y--G--H--A--V--L--S--Y--M--D--L--V--Y--V--I

--------------------><------------------------------------------------------------------------------
--G--G--K--G--S--D--R--K--C--L--N--K--M--C--V--Y--D--P--K--K--F--E--W--K--E--L--A--P--M--Q--T--A--R-
TGGCGGCAAAGGCAGTGACAGGAAGTGCCTGAACAAGATGTGCGTCTATGACCCCAAGAAGTTTGAGTGGAAGGAGCTGGCACCCATGCAGACCGCCCGC
:::.:::::::::::.:::   ::::::::::::::::::::::::::::::::.:::::.::.:::::::.::::::::: ::.:::::::. ::::::
TGGTGGCAAAGGCAGCGAC---AAGTGCCTGAACAAGATGTGCGTCTATGACCCTAAGAAATTCGAGTGGAGGGAGCTGGCCCCTATGCAGATGGCCCGC
--G--G--K--G--S--D-----K--C--L--N--K--M--C--V--Y--D--P--K--K--F--E--W--R--E--L--A--P--M--Q--M--A--R-

----------------------------------------------------------------------------------------------------
-S--L--F--G--A--T--V--H--D--G--R--I--I--V--A--A--G--V--T--D--T--G--L--T--S--S--A--E--V--Y--S--I--T--
TCACTCTTTGGGGCCACTGTCCATGATGGCCGCATTATCGTGGCAGCTGGGGTCACCGACACAGGGCTGACCAGTTCTGCCGAAGTGTACAGCATCACAG
::::::::.::::::::.:::::::::::::::::: ::::::: ::::::::::: :::::::::::::::::::: :: ::.::::::::::::::::
TCACTCTTCGGGGCCACCGTCCATGATGGCCGCATTTTCGTGGCTGCTGGGGTCACAGACACAGGGCTGACCAGTTCGGCGGAGGTGTACAGCATCACAG
-S--L--F--G--A--T--V--H--D--G--R--I--F--V--A--A--G--V--T--D--T--G--L--T--S--S--A--E--V--Y--S--I--T--

------><--------------------------------------------------------------------------------------------
D--N--K--W--A--P--F--E--A--F--P--Q--E--R--S--S--L--S--L--V--S--L--V--G--T--L--Y--A--I--G--G--F--A--T
ACAACAAGTGGGCACCCTTCGAGGCCTTCCCACAGGAGCGTAGCTCACTCAGCCTGGTCAGCCTGGTGGGTACCCTCTATGCCATTGGTGGCTTTGCCAC
:::::   :::::.:::::.::::::::::::::::::::.:::::::: ::::::::::::::::.:::::::::::::::..:.::::::::::::::
ACAAC---TGGGCGCCCTTTGAGGCCTTCCCACAGGAGCGCAGCTCACTGAGCCTGGTCAGCCTGGCGGGTACCCTCTATGCTGTCGGTGGCTTTGCCAC
D--N-----W--A--P--F--E--A--F--P--Q--E--R--S--S--L--S--L--V--S--L--A--G--T--L--Y--A--V--G--G--F--A--T

-----------------------------------------------------><---------------------------------------------
--L--E--T--E--S--G--E--L--V--P--T--E--L--N--D--I--W--R--Y--N--E--E--E--K--K--W--E--G--V--L--R--E--I-
ACTGGAGACGGAGTCTGGAGAGCTGGTTCCCACAGAGCTCAATGACATCTGGAGGTATAACGAGGAGGAGAAGAAATGGGAGGGTGTCCTGCGGGAGATC
.:::::::: :::::.::::::::::::::::::::.::::::::::: :::   :::::.::::: ::::::::.::::::::.::::::::::::::.
GCTGGAGACTGAGTCCGGAGAGCTGGTTCCCACAGAACTCAATGACATATGG---TATAATGAGGACGAGAAGAAGTGGGAGGGCGTCCTGCGGGAGATT
--L--E--T--E--S--G--E--L--V--P--T--E--L--N--D--I--W-----Y--N--E--D--E--K--K--W--E--G--V--L--R--E--I-

----------------------------------------------------------------->
-A--Y--A--A--G--A--T--F--L--P--V--R--L--N--V--L--C--L--T--K--M--*-
GCCTATGCAGCAGGTGCCACCTTCCTACCAGTGCGGCTCAATGTGCTGTGCCTGACTAAGATGTGA
:::::::: :: :: :::::::::::::: :::::::::::.::::::.:::::::.::: :::::
GCCTATGCCGCTGGGGCCACCTTCCTACCTGTGCGGCTCAACGTGCTGCGCCTGACCAAGCTGTGA
-A--Y--A--A--G--A--T--F--L--P--V--R--L--N--V--L--R--L--T--K--L--*-

Pig Consensus Sequence

>BGISUST0000898602
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------TCATAGTGGCTGGGTATGCCGCCTCTGCCATCG
CCGCGTTGCCTCTTCGGCCTGGGAGAGGCTCTCAACTCCATTTACGTGGTCGGCGGCCGAGAGCTCAAGGACGGCGAGCGCAGCCTGGACTCGGTCATGT
GCTACGACAGG---TCATTCAAATGGGGCGAATCAGACCCGCTGCCTTATGCCGTGTATGGCCACGCGGTGCTCTCCTACATGGACCTTGTCTATGTCAT
TGGTGGCAAAGGCAGCGAC---AAGTGCCTGAACAAGATGTGCGTCTATGACCCTAAGAAATTCGAGTGGAGGGAGCTGGCCCCTATGCAGATGGCCCGC
TCACTCTTCGGGGCCACCGTCCATGATGGCCGCATTTTCGTGGCTGCTGGGGTCACAGACACAGGGCTGACCAGTTCGGCGGAGGTGTACAGCATCACAG
ACAAC---TGGGCGCCCTTTGAGGCCTTCCCACAGGAGCGCAGCTCACTGAGCCTGGTCAGCCTGGCGGGTACCCTCTATGCTGTCGGTGGCTTTGCCAC
GCTGGAGACTGAGTCCGGAGAGCTGGTTCCCACAGAACTCAATGACATATGG---TATAATGAGGACGAGAAGAAGTGGGAGGGCGTCCTGCGGGAGATT
GCCTATGCCGCTGGGGCCACCTTCCTACCTGTGCGGCTCAACGTGCTGCGCCTGACCAAGCTGTGA


>BGISUSP0000898602
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------------S*WLGMPPLPS
PRCLFGLGEALNSIYVVGGRELKDGERSLDSVMCYDR-SFKWGESDPLPYAVYGHAVLSYMDLVYVIGGKGSD-KCLNKMCVYDPKKFEWRELAPMQMAR
SLFGATVHDGRIFVAAGVTDTGLTSSAEVYSITDN-WAPFEAFPQERSSLSLVSLAGTLYAVGGFATLETESGELVPTELNDIW-YNEDEKKWEGVLREI
AYAAGATFLPVRLNVLRLTKL*