Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000187672 (click for geneview)
Transcript ID ENST00000288221(link to ensembl)
Symbol ERC2_HUMAN
Localtion Chromosome:3:55517376:56477431:-1 band: 3p14.3
Description ERC protein 2.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-H--F--F--S--S--V--T--P--H--N--T--R--K--M--Y--G--S--A--R--T--I--T--N--L--E--G--S--P--S--R--S--P--R--
CATTTCTTCTCTTCAGTAACACCTCATAATACAAGAAAAATGTATGGAAGTGCAAGAACAATCACCAATCTGGAAGGTAGCCCTTCCAGATCCCCTCGTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--P--R--S--P--R--L--G--H--R--R--T--S--S--G--G--G--G--G--T--G--K--T--L--S--M--E--N--I--Q--S--L--N--A
TGCCAAGGTCTCCTCGTTTGGGCCACCGAAGAACAAGTAGTGGGGGAGGTGGAGGAACAGGCAAGACTCTGTCTATGGAGAATATCCAGTCCCTCAATGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--Y--A--T--S--G--P--M--Y--L--S--D--H--E--G--V--A--S--T--T--Y--P--K--G--T--M--T--L--G--R--A--T--N-
AGCCTATGCTACGTCTGGACCCATGTATCTGAGTGATCATGAAGGGGTGGCTTCAACAACCTACCCAAAGGGCACTATGACTCTGGGAAGGGCTACAAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-R--A--V--Y--G--G--R--V--T--A--M--G--S--S--P--N--I--A--S--A--G--L--S--H--T--D--V--L--S--Y--T--D--Q--
CGAGCTGTATATGGAGGCCGTGTCACAGCCATGGGGAGTAGTCCCAATATTGCTTCTGCTGGACTTTCCCACACAGATGTCCTTTCATACACAGATCAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
H--G--G--L--T--G--S--S--H--H--H--H--H--Q--V--P--S--M--L--R--Q--V--R--D--S--T--M--L--D--L--Q--A--Q--L
ATGGTGGGCTGACTGGCTCATCCCATCATCACCACCACCAGGTCCCCTCCATGTTGAGGCAGGTAAGAGACAGCACAATGTTAGATCTTCAGGCCCAGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--E--L--Q--R--E--N--D--L--L--R--K--E--L--D--I--K--D--S--K--L--G--S--S--M--N--S--I--K--T--F--W--S-
GAAAGAACTGCAGAGAGAGAATGACCTCCTCCGGAAAGAGCTAGACATCAAGGACAGCAAATTGGGATCTTCCATGAACAGTATTAAGACTTTCTGGAGT
                                                                                     :::::.:::::::::
-------------------------------------------------------------------------------------AAGACCTTCTGGAGT
--------------------------------------------------------------------------------------K--T--F--W--S-

-----------------------------------------------------------------------------------------------><---
-P--E--L--K--K--E--R--V--L--R--K--E--E--A--A--R--M--S--V--L--K--E--Q--M--R--V--S--H--E--E--N--Q--H--
CCTGAGCTTAAGAAGGAGAGAGTCTTGAGGAAAGAAGAGGCAGCGCGGATGTCTGTCCTCAAGGAGCAGATGAGGGTTTCCCATGAAGAAAATCAGCACC
::.:::::.:::::::::::::::::::::::::::::: :::: ::::::::::::::.::::::::::::::::::::::::::::::::::::    
CCCGAGCTCAAGAAGGAGAGAGTCTTGAGGAAAGAAGAGTCAGCCCGGATGTCTGTCCTTAAGGAGCAGATGAGGGTTTCCCATGAAGAAAATCAG----
-P--E--L--K--K--E--R--V--L--R--K--E--E--S--A--R--M--S--V--L--K--E--Q--M--R--V--S--H--E--E--N--Q-----

----------------------------------------------------------------------------------------------------
L--Q--L--T--I--Q--A--L--Q--D--E--L--R--T--Q--R--D--L--N--H--L--L--Q--Q--E--S--G--N--R--G--A--E--H--F
TACAGTTGACAATCCAGGCCCTTCAAGATGAGCTGCGAACCCAGAGAGACCTCAACCACCTCCTCCAGCAAGAGAGTGGCAACCGAGGAGCGGAGCACTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--I--E--L--T--E--E--N--F--R--R--L--Q--A--E--H--D--R--Q--A--K--E--L--F--L--L--R--K--T--L--E--E--M-
CACCATCGAGCTGACCGAGGAGAACTTTAGGCGGCTCCAAGCCGAGCATGACAGGCAGGCTAAGGAGCTGTTCCTTTTGAGGAAGACATTAGAGGAAATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-E--L--R--I--E--T--Q--K--Q--T--L--N--A--R--D--E--S--I--K--K--L--L--E--M--L--Q--S--K--G--L--P--S--K--
GAGCTGAGAATTGAAACGCAGAAACAAACCCTCAATGCCCGAGATGAGTCAATTAAAAAACTTCTTGAGATGTTGCAAAGTAAAGGCTTGCCATCCAAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--L--E--D--D--N--E--R--T--R--R--M--A--E--A--E--S--Q--V--S--H--L--E--V--I--L--D--Q--K--E--K--E--N--I
GCCTGGAGGATGACAATGAGCGAACGCGGCGGATGGCAGAGGCTGAGTCTCAGGTCAGCCACTTGGAAGTGATTTTAGATCAGAAAGAGAAGGAAAACAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------><-------------------------------------------------------------------------><-----------
--H--L--R--E--E--L--H--R--R--S--Q--L--Q--P--E--P--A--K--T--K--A--L--Q--T--V--I--E--M--K--D--T--K--I-
ACATCTTAGAGAGGAATTGCACCGAAGAAGCCAACTTCAGCCGGAGCCAGCCAAGACGAAGGCTCTCCAGACTGTCATCGAAATGAAGGACACAAAAATC
                                                                                              :::::.
----------------------------------------------------------------------------------------------AAAATT
-----------------------------------------------------------------------------------------------K--I-

----------------------------------------------------------------------------------------------------
-A--S--L--E--R--N--I--R--D--L--E--D--E--I--Q--M--L--K--A--N--G--V--L--N--T--E--D--R--E--E--E--I--K--
GCTTCATTGGAACGAAACATAAGGGATCTTGAGGATGAGATCCAGATGTTAAAAGCCAATGGTGTGCTGAACACTGAGGACCGCGAAGAAGAGATCAAAC
:::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::.::::::::::: ::::
GCTTCATTGGAGCGAAACATAAGGGATCTTGAGGATGAGATCCAGATGTTAAAAGCCAATGGTGTGCTAAACACTGAGGACCGTGAAGAAGAGATAAAAC
-A--S--L--E--R--N--I--R--D--L--E--D--E--I--Q--M--L--K--A--N--G--V--L--N--T--E--D--R--E--E--E--I--K--

-------------------------------------------><-------------------------------------------------------
Q--I--E--V--Y--K--S--H--S--K--F--M--K--T--K--I--D--Q--L--K--Q--E--L--S--K--K--E--S--E--L--L--A--L--Q
AAATTGAGGTTTACAAAAGTCACTCCAAGTTTATGAAGACCAAGATTGATCAGCTGAAGCAGGAACTTTCAAAGAAAGAGTCGGAACTTCTTGCCTTACA
:::: ::::::::::::::::::::::::::.:::::::::::::: :::::::::::.::::::::::::::.::.:::::.:::::::::::::::::
AAATAGAGGTTTACAAAAGTCACTCCAAGTTCATGAAGACCAAGATGGATCAGCTGAAACAGGAACTTTCAAAAAAGGAGTCAGAACTTCTTGCCTTACA
Q--I--E--V--Y--K--S--H--S--K--F--M--K--T--K--M--D--Q--L--K--Q--E--L--S--K--K--E--S--E--L--L--A--L--Q

----------------------------------------------------------------------------------------------------
--T--K--L--E--T--L--S--N--Q--N--S--D--C--K--Q--H--I--E--V--L--K--E--S--L--T--A--K--E--Q--R--A--A--I-
AACAAAGCTTGAAACCCTCAGCAATCAAAATTCAGATTGCAAGCAACACATTGAAGTGCTCAAAGAGTCACTTACTGCCAAAGAACAGAGGGCTGCCATC
::::::::::::::::::.::::::::.::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::
AACAAAGCTTGAAACCCTTAGCAATCAGAATTCAGATTGCAAGCAACACATTGAAGTGCTTAAAGAGTCACTTACTGCCAAAGAACAGAGGGCTGCCATC
--T--K--L--E--T--L--S--N--Q--N--S--D--C--K--Q--H--I--E--V--L--K--E--S--L--T--A--K--E--Q--R--A--A--I-

-----------><---------------------------------------------------------------------------------------
-L--Q--T--E--V--D--A--L--R--L--R--L--E--E--K--E--S--F--L--N--K--K--T--K--Q--L--Q--D--L--T--E--E--K--
CTTCAGACTGAGGTAGATGCGCTGAGATTACGACTGGAAGAAAAAGAATCTTTCCTCAATAAAAAAACAAAACAGCTACAGGACCTCACAGAAGAGAAGG
::::::::::::::::::::.::::::::::::::.:::::.:::::::::::.::::::::::::::.::::::::.::::::::::: ::::::::::
CTTCAGACTGAGGTAGATGCACTGAGATTACGACTAGAAGAGAAAGAATCTTTTCTCAATAAAAAAACGAAACAGCTGCAGGACCTCACCGAAGAGAAGG
-L--Q--T--E--V--D--A--L--R--L--R--L--E--E--K--E--S--F--L--N--K--K--T--K--Q--L--Q--D--L--T--E--E--K--

-------------------------------------------------------------------------------><-------------------
G--T--L--A--G--E--I--R--D--M--K--D--M--L--E--V--K--E--R--K--I--N--V--L--Q--K--K--I--E--N--L--Q--E--Q
GGACACTGGCCGGTGAAATTCGTGACATGAAAGATATGTTAGAAGTGAAGGAAAGAAAAATCAATGTTCTTCAGAAAAAGATTGAAAACTTGCAAGAACA
:::: :::::.:: ::.::::: ::.:::::.:::::::::::::::::::::::.:::::::::::.:::::.::::::                    
GGACTCTGGCTGGAGAGATTCGAGATATGAAGGATATGTTAGAAGTGAAGGAAAGGAAAATCAATGTCCTTCAAAAAAAG--------------------
G--T--L--A--G--E--I--R--D--M--K--D--M--L--E--V--K--E--R--K--I--N--V--L--Q--K--K---------------------

----------------------------------------------------------------------------------------------------
--L--R--D--K--D--K--Q--L--T--N--L--K--D--R--V--K--S--L--Q--T--D--S--S--N--T--D--T--A--L--A--T--L--E-
ACTTAGGGATAAAGACAAGCAACTGACCAACCTGAAAGACAGAGTGAAGTCCTTGCAGACGGATTCCAGTAATACAGATACTGCACTGGCGACGCTAGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------><---------------------------------------------------------------------------------
-E--A--L--S--E--K--E--R--I--I--E--R--L--K--E--Q--R--E--R--D--D--R--E--R--L--E--E--I--E--S--F--R--K--
GAAGCTCTGTCAGAGAAGGAGAGAATAATTGAGCGCTTGAAAGAACAGCGAGAAAGAGATGATCGGGAAAGACTAGAAGAGATAGAATCCTTCCGAAAAG
                  ::.::.::::::::.::.:::::::::::.:::::.::::::::::::::::::::::::::::::::.:: ::::::::::
------------------GAAAGGATAATTGAACGTTTGAAAGAACAACGAGAGAGAGATGATCGGGAAAGACTAGAAGAGATAGAGTCATTCCGAAAAG
-------------------E--R--I--I--E--R--L--K--E--Q--R--E--R--D--D--R--E--R--L--E--E--I--E--S--F--R--K--

----------------------------------------------------------><----------------------------------------
E--N--K--D--L--K--E--K--V--N--A--L--Q--A--E--L--T--E--K--E--S--S--L--I--D--L--K--E--H--A--S--S--L--A
AGAACAAAGACCTGAAAGAGAAGGTCAATGCTTTACAGGCTGAACTGACTGAGAAAGAGTCTAGTTTAATTGACCTCAAAGAACATGCATCTTCATTAGC
::::::::::::::::.::::::::::::::::::::.                     :::::::::::::::::.::.::::::::::::::::::::
AGAACAAAGACCTGAAGGAGAAGGTCAATGCTTTACAA---------------------TCTAGTTTAATTGACCTTAAGGAACATGCATCTTCATTAGC
E--N--K--D--L--K--E--K--V--N--A--L--Q-----------------------S--S--L--I--D--L--K--E--H--A--S--S--L--A

--------------------------------------------------------------------------------------------------->
--S--A--G--L--K--R--D--S--K--L--K--S--L--E--I--A--I--E--Q--K--K--E--E--C--S--K--L--E--A--Q--L--K--K-
CTCTGCGGGGCTGAAAAGGGATTCCAAATTAAAATCTCTAGAAATAGCCATTGAACAAAAGAAAGAGGAATGTAGCAAATTGGAAGCACAGTTAAAAAAG
::: :: :::::::::::.::.::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.:::
CTCAGCTGGGCTGAAAAGAGACTCCAAATTAAAATCTCTAGAAATAGCCATTGAACAAAAGAAAGAAGAATGTAGCAAATTGGAAGCACAGTTAAAGAAG
--S--A--G--L--K--R--D--S--K--L--K--S--L--E--I--A--I--E--Q--K--K--E--E--C--S--K--L--E--A--Q--L--K--K-

<---------------------------------------------------------------------------------------------------
-A--H--N--I--E--D--D--S--R--M--N--P--E--F--A--D--Q--I--K--Q--L--D--K--E--A--S--Y--Y--R--D--E--C--G--
GCACATAATATTGAAGATGACTCCAGGATGAACCCTGAGTTTGCAGACCAAATAAAACAGCTCGATAAAGAGGCGTCTTACTACCGCGACGAGTGTGGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------------------><-----
K--A--Q--A--E--V--D--R--L--L--E--I--L--K--E--V--E--N--E--K--N--D--K--D--K--K--I--A--E--L--E--S--V--A
AGGCCCAAGCGGAAGTGGACCGGTTGCTGGAGATCCTCAAGGAGGTGGAGAATGAGAAGAATGACAAGGACAAGAAGATCGCAGAACTGGAGAGTGTTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----><---------------------------------------------------------------------------------------------
--S--E--H--M--K--D--Q--N--K--K--V--A--N--L--K--H--N--Q--Q--L--E--K--K--K--N--A--Q--L--L--E--E--V--R-
ATCAGAGCATATGAAAGATCAGAATAAGAAGGTGGCCAACCTCAAGCACAATCAACAGTTGGAAAAGAAGAAAAATGCTCAGTTACTAGAAGAAGTGCGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------><---------------------------------------------------------
-R--R--E--D--S--M--A--D--N--S--Q--H--L--Q--I--E--E--L--M--N--A--L--E--K--T--R--Q--E--L--D--A--T--K--
AGGCGAGAAGACAGCATGGCTGACAACTCACAGCATTTGCAGATAGAGGAACTGATGAATGCACTGGAGAAGACCAGACAGGAACTGGATGCCACCAAAG
                                          :::::::::::::::::::::::::::::::::::::::: :::::::::::::::.:
------------------------------------------ATAGAGGAACTGATGAATGCACTGGAGAAGACCAGACAGGCACTGGATGCCACCAAGG
-------------------------------------------I--E--E--L--M--N--A--L--E--K--T--R--Q--A--L--D--A--T--K--

----------------------------------------------------------------------------------------------------
A--R--L--A--S--T--Q--Q--S--L--A--E--K--E--A--H--L--A--N--L--R--I--E--R--R--K--Q--L--E--E--I--L--E--M
CACGCCTCGCCTCCACACAACAGTCCCTGGCCGAAAAAGAAGCGCACTTGGCCAACCTCCGGATTGAGAGGAGGAAACAGCTGGAGGAGATCCTGGAGAT
:::::::.:::::::::::.:::::::::::.:::::::::::.:::::::::::::::::::: ::::::::.::::::::::::::::::::::::::
CACGCCTTGCCTCCACACAGCAGTCCCTGGCTGAAAAAGAAGCACACTTGGCCAACCTCCGGATAGAGAGGAGAAAACAGCTGGAGGAGATCCTGGAGAT
A--R--L--A--S--T--Q--Q--S--L--A--E--K--E--A--H--L--A--N--L--R--I--E--R--R--K--Q--L--E--E--I--L--E--M

--><------------------------------------------------------------------------------------------------
--K--Q--E--A--L--L--A--A--I--S--E--K--D--A--N--I--A--L--L--E--L--S--A--S--K--K--K--K--T--Q--E--E--V-
GAAACAGGAAGCACTACTTGCAGCCATCAGTGAAAAAGATGCAAACATTGCCTTGCTGGAATTGTCTGCCTCCAAAAAGAAAAAGACGCAGGAAGAAGTC
:                                                                                                   
G---------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------><------------------------------------------------
-M--A--L--K--R--E--K--D--R--L--V--H--Q--L--K--Q--Q--T--Q--N--R--M--K--L--M--A--D--N--Y--D--D--D--H--
ATGGCCCTCAAGCGGGAAAAAGACCGACTAGTACATCAATTAAAGCAGCAGACCCAGAACAGAATGAAGTTGATGGCAGACAACTATGATGATGACCATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------------------------><-------------
H--H--Y--H--H--H--H--H--H--H--H--H--R--S--P--G--R--S--Q--H--S--N--H--R--P--S--P--D--Q--D--D--E--E--G
ACCATTACCACCACCACCACCATCACCACCACCATCGATCTCCTGGGAGGTCGCAACATTCCAATCACAGGCCCTCTCCGGACCAGGATGACGAGGAGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------>
--I--W--A--*-
CATATGGGCATAG
             
-------------
-------------

Pig Consensus Sequence

>BGISUST0000887023
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------AAGACCTTCTGGAGT
CCCGAGCTCAAGAAGGAGAGAGTCTTGAGGAAAGAAGAGTCAGCCCGGATGTCTGTCCTTAAGGAGCAGATGAGGGTTTCCCATGAAGAAAATCAG----
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------AAAATT
GCTTCATTGGAGCGAAACATAAGGGATCTTGAGGATGAGATCCAGATGTTAAAAGCCAATGGTGTGCTAAACACTGAGGACCGTGAAGAAGAGATAAAAC
AAATAGAGGTTTACAAAAGTCACTCCAAGTTCATGAAGACCAAGATGGATCAGCTGAAACAGGAACTTTCAAAAAAGGAGTCAGAACTTCTTGCCTTACA
AACAAAGCTTGAAACCCTTAGCAATCAGAATTCAGATTGCAAGCAACACATTGAAGTGCTTAAAGAGTCACTTACTGCCAAAGAACAGAGGGCTGCCATC
CTTCAGACTGAGGTAGATGCACTGAGATTACGACTAGAAGAGAAAGAATCTTTTCTCAATAAAAAAACGAAACAGCTGCAGGACCTCACCGAAGAGAAGG
GGACTCTGGCTGGAGAGATTCGAGATATGAAGGATATGTTAGAAGTGAAGGAAAGGAAAATCAATGTCCTTCAAAAAAAG--------------------
----------------------------------------------------------------------------------------------------
------------------GAAAGGATAATTGAACGTTTGAAAGAACAACGAGAGAGAGATGATCGGGAAAGACTAGAAGAGATAGAGTCATTCCGAAAAG
AGAACAAAGACCTGAAGGAGAAGGTCAATGCTTTACAA---------------------TCTAGTTTAATTGACCTTAAGGAACATGCATCTTCATTAGC
CTCAGCTGGGCTGAAAAGAGACTCCAAATTAAAATCTCTAGAAATAGCCATTGAACAAAAGAAAGAAGAATGTAGCAAATTGGAAGCACAGTTAAAGAAG
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------ATAGAGGAACTGATGAATGCACTGGAGAAGACCAGACAGGCACTGGATGCCACCAAGG
CACGCCTTGCCTCCACACAGCAGTCCCTGGCTGAAAAAGAAGCACACTTGGCCAACCTCCGGATAGAGAGGAGAAAACAGCTGGAGGAGATCCTGGAGAT
G---------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------


>BGISUSP0000887023
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------------------KTFWS
PELKKERVLRKEESARMSVLKEQMRVSHEENQ--------------------------------------------------------------------
--------------------------------------------------------------------------------------------------KI
ASLERNIRDLEDEIQMLKANGVLNTEDREEEIKQIEVYKSHSKFMKTKMDQLKQELSKKESELLALQTKLETLSNQNSDCKQHIEVLKESLTAKEQRAAI
LQTEVDALRLRLEEKESFLNKKTKQLQDLTEEKGTLAGEIRDMKDMLEVKERKINVLQKK----------------------------------------
------ERIIERLKEQRERDDRERLEEIESFRKENKDLKEKVNALQ-------SSLIDLKEHASSLASAGLKRDSKLKSLEIAIEQKKEECSKLEAQLKK
----------------------------------------------------------------------------------------------------
--------------IEELMNALEKTRQALDATKARLASTQQSLAEKEAHLANLRIERRKQLEEILEM---------------------------------
-----------------------------------------------------------------------