Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000157680 (click for geneview)
Transcript ID ENST00000288490(link to ensembl)
Symbol DGKI
Localtion Chromosome:7:136530818:136988863:-1 band: 7q33
Description Diacylglycerol kinase, iota (EC 2.7.1.107) (Diglyceride kinase) (DGK- iota) (DAG kinase iota). [Source:Uniprot/SWISSPROT;Acc:O75912]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--D--A--A--G--R--G--C--H--L--L--P--L--P--A--A--R--G--P--A--R--A--P--A--A--A--A--A--A--A--A--S--P--
ATGGATGCTGCGGGAAGGGGCTGCCATTTGCTGCCCCTGCCAGCGGCGCGCGGACCTGCCCGCGCTCCTGCAGCCGCCGCCGCCGCCGCCGCCAGCCCGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--G--P--C--S--G--A--A--C--A--P--S--A--A--A--G--A--G--A--M--N--P--S--S--S--A--G--E--E--K--G--A--T--G
CCGGCCCCTGCAGCGGCGCCGCCTGCGCTCCCTCCGCGGCCGCCGGAGCGGGCGCCATGAACCCCAGCTCCTCGGCGGGAGAGGAGAAAGGGGCGACGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--S--S--S--S--G--S--G--A--G--S--C--C--L--G--A--E--G--G--A--D--P--R--G--A--G--S--A--A--A--A--G--A-
CGGCAGCAGCAGCAGCGGAAGCGGCGCCGGGAGCTGCTGCCTGGGCGCCGAGGGCGGCGCGGACCCGCGGGGCGCAGGGTCAGCCGCGGCGGCGGGGGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--A--L--D--E--P--A--A--A--G--Q--K--E--K--D--E--A--L--E--E--K--L--R--N--L--T--F--R--K--Q--V--S--Y--
GCTGCCCTGGACGAGCCCGCGGCCGCCGGCCAGAAGGAGAAGGACGAAGCGCTGGAGGAGAAGCTGAGGAACTTAACTTTCCGGAAGCAGGTCTCGTACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

><--------------------------------------------------------------------------------------------------
R--K--A--I--S--R--A--G--L--Q--H--L--A--P--A--H--P--L--S--L--P--V--A--N--G--P--A--K--E--P--R--A--T--L
GGAAAGCAATCTCCCGGGCAGGCCTCCAGCATCTGGCTCCTGCACATCCCCTCAGCCTTCCTGTGGCAAATGGTCCAGCCAAGGAGCCCAGAGCGACTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------><-----------------------------------------------------------------------------------------
--D--W--S--E--N--A--V--N--G--E--H--L--W--L--E--T--N--V--S--G--D--L--C--Y--L--G--E--E--N--C--Q--V--R-
GGACTGGAGTGAGAATGCCGTGAATGGAGAACACCTGTGGCTGGAGACCAACGTCTCGGGAGACCTCTGCTACCTTGGAGAGGAGAACTGCCAAGTCAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----><----------------------------------------------------------------------------><---------------
-F--A--K--S--A--L--R--R--K--C--A--V--C--K--I--V--V--H--T--A--C--I--E--Q--L--E--K--I--N--F--R--C--K--
TTTGCAAAATCAGCTCTCAGGAGGAAGTGTGCAGTCTGTAAAATCGTCGTCCACACCGCCTGCATTGAGCAGCTAGAAAAGATTAATTTCAGATGTAAAC
      :::...::::::::::.:::::::::::::::::::::.:  ::::::: .:::::::.:::. ::::.:::::::::::::::::::::::::
------AAACTGGCTCTCAGGAAGAAGTGTGCAGTCTGTAAAATTGG-GTCCACAGTGCCTGCACTGAAAAGCTGGAAAAGATTAATTTCAGATGTAAAC
-------K--L--A--L--R--K--K--C--A--V--C--K--I--V--V--H--S--A--C--T--E--K--L--E--K--I--N--F--R--C--K--

----------------------------------------><----------------------------------------------------------
P--T--F--R--E--G--G--S--R--S--P--R--E--N--F--V--R--H--H--W--V--H--R--R--R--Q--E--G--K--C--K--Q--C--G
CAACATTTCGAGAAGGAGGCTCAAGGTCACCAAGAGAAAATTTTGTACGTCATCACTGGGTGCACAGGCGTCGGCAGGAGGGGAAATGTAAGCAGTGTGG
::::::::::::::::.::::::::.:: ::::::::::::::::: :::::::::::::::::::::::::::::::::::.::.:::::::::::.::
CAACATTTCGAGAAGGGGGCTCAAGATCTCCAAGAGAAAATTTTGTCCGTCATCACTGGGTGCACAGGCGTCGGCAGGAGGGAAAGTGTAAGCAGTGCGG
P--T--F--R--E--G--G--S--R--S--P--R--E--N--F--V--R--H--H--W--V--H--R--R--R--Q--E--G--K--C--K--Q--C--G

------><----------------------------------------------------------------------><--------------------
--K--G--F--Q--Q--K--F--S--F--H--S--K--E--I--V--A--I--S--C--S--W--C--K--Q--A--F--H--N--K--V--T--C--F-
TAAGGGCTTCCAGCAAAAGTTCTCCTTCCACAGTAAAGAGATTGTGGCTATCAGCTGTTCCTGGTGCAAGCAGGCGTTTCACAATAAGGTGACCTGCTTC
::::                                                                        ::::::::::::::::::::::::
TAAG------------------------------------------------------------------------TTTCACAATAAGGTGACCTGCTTC
--K--------------------------------------------------------------------------F--H--N--K--V--T--C--F-

-----------------------------------------------------------------------------------------------><---
-M--L--H--H--I--E--E--P--C--S--L--G--A--H--A--A--V--I--V--P--P--T--W--I--I--K--V--K--K--P--Q--N--S--
ATGCTGCATCACATTGAAGAACCCTGCTCCCTGGGGGCTCATGCTGCTGTTATTGTCCCGCCCACTTGGATCATTAAGGTGAAGAAACCTCAGAACTCCC
:::::::::::::::::.::::::::::: :::::::::::::::::::::::.:::::::::::.::::::::::::::::::::::::::::::::.:
ATGCTGCATCACATTGAGGAACCCTGCTCGCTGGGGGCTCATGCTGCTGTTATCGTCCCGCCCACCTGGATCATTAAGGTGAAGAAACCTCAGAACTCTC
-M--L--H--H--I--E--E--P--C--S--L--G--A--H--A--A--V--I--V--P--P--T--W--I--I--K--V--K--K--P--Q--N--S--

----------------------------------------------------------------------><----------------------------
L--K--A--S--N--R--K--K--K--R--T--S--F--K--R--K--A--S--K--R--G--M--E--Q--E--N--K--G--R--P--F--V--I--K
TGAAGGCTTCAAATCGGAAGAAGAAGAGAACAAGCTTTAAAAGAAAAGCCAGTAAAAGAGGGATGGAACAGGAAAACAAAGGTCGTCCTTTTGTGATAAA
:::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::.:.:::::::::::::::::: :::::::::::::::::
TGAAGGCTTCCAATCGGAAGAAGAAGAGAACAAGCTTTAAAAGAAAAGCCAGTAAAAGAGGAACGGAACAGGAAAACAAAGGGCGTCCTTTTGTGATAAA
L--K--A--S--N--R--K--K--K--R--T--S--F--K--R--K--A--S--K--R--G--T--E--Q--E--N--K--G--R--P--F--V--I--K

---------------------------------------------------------------------><-----------------------------
--P--I--S--S--P--L--M--K--P--L--L--V--F--V--N--P--K--S--G--G--N--Q--G--T--K--V--L--Q--M--F--M--W--Y-
ACCCATCTCTTCTCCTCTCATGAAACCCTTGCTTGTATTTGTGAATCCCAAGAGTGGAGGCAACCAGGGAACCAAAGTCCTGCAGATGTTCATGTGGTAC
:::.:::::::: :::::::::::::::::::::::.::::::::.:::::::::::::::::::::                                 
ACCTATCTCTTCACCTCTCATGAAACCCTTGCTTGTGTTTGTGAACCCCAAGAGTGGAGGCAACCAG---------------------------------
--P--I--S--S--P--L--M--K--P--L--L--V--F--V--N--P--K--S--G--G--N--Q----------------------------------

----------------------------------------------------><----------------------------------------------
-L--N--P--R--Q--V--F--D--L--S--Q--E--G--P--K--D--A--L--E--L--Y--R--K--V--P--N--L--R--I--L--A--C--G--
CTGAATCCACGGCAAGTCTTTGATCTTTCTCAGGAAGGGCCAAAAGATGCGCTTGAATTGTATAGGAAAGTACCAAATCTGCGAATTCTGGCCTGTGGTG
                                                   :::::.:::::::::::::::::::::::::::::::::::::::::::
---------------------------------------------------CTTGAGTTGTATAGGAAAGTACCAAATCTGCGAATTCTGGCCTGTGGTG
----------------------------------------------------L--E--L--Y--R--K--V--P--N--L--R--I--L--A--C--G--

-------------><-------------------------------------------------------------------------------------
G--D--G--T--V--G--W--I--L--S--I--L--D--E--L--Q--L--S--P--Q--P--P--V--G--V--L--P--L--G--T--G--N--D--L
GGGATGGAACGGTGGGCTGGATCCTTTCCATCCTGGATGAACTGCAGCTGAGCCCTCAGCCTCCTGTGGGGGTCCTTCCTCTGGGGACTGGGAATGACCT
:::::::::::                                                                                         
GGGATGGAACG-----------------------------------------------------------------------------------------
G--D--G--T------------------------------------------------------------------------------------------

---------------------------><-----------------------------------------------------------------------
--A--R--T--L--N--W--G--G--G--Y--T--D--E--P--V--S--K--I--L--C--Q--V--E--D--G--T--V--V--Q--L--D--R--W-
GGCTCGAACTCTCAACTGGGGAGGGGGCTACACTGATGAACCTGTTTCTAAGATCCTGTGTCAAGTGGAAGATGGGACAGTTGTACAGCTAGATCGCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------------------------------><---------------------------------
-N--L--H--V--E--R--N--P--D--L--P--P--E--E--L--E--D--G--V--C--K--L--P--L--N--V--F--N--N--Y--F--S--L--
AACCTCCATGTGGAAAGAAACCCCGACTTGCCTCCAGAAGAACTTGAAGATGGCGTATGTAAGCTCCCTCTGAATGTTTTCAATAACTACTTCAGCCTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------><------------------------------------------------------
G--F--D--A--H--V--T--L--E--F--H--E--S--R--E--A--N--P--E--K--F--N--S--R--F--R--N--K--M--F--Y--A--G--A
GATTTGATGCCCATGTCACACTGGAGTTCCATGAATCCAGAGAAGCAAATCCAGAGAAATTCAACAGTCGTTTTCGAAATAAAATGTTCTATGCAGGGGC
                                                                                                  ::
--------------------------------------------------------------------------------------------------GC
---------------------------------------------------------------------------------------------------A

><-------------------------------------------------------------><-----------------------------------
--A--F--S--D--F--L--Q--R--S--S--R--D--L--S--K--H--V--K--V--V--C--D--G--T--D--L--T--P--K--I--Q--E--L-
AGCTTTTTCTGACTTCCTACAGAGAAGTTCTAGAGATCTATCCAAACATGTTAAAGTTGTTTGTGATGGAACAGATCTCACCCCAAAGATTCAGGAACTG
:::.::::::::.::.:::::::::::.::: ::::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::::
AGCCTTTTCTGATTTTCTACAGAGAAGCTCTCGAGATCTATCCAAACATGTTAAAGTT---TGTGATGGAACAGATCTCACCCCAAAGATTCAGGAACTG
--A--F--S--D--F--L--Q--R--S--S--R--D--L--S--K--H--V--K--V-----C--D--G--T--D--L--T--P--K--I--Q--E--L-

-------------------------------------><-------------------------------------------------------------
-K--F--Q--C--I--V--F--L--N--I--P--R--Y--C--A--G--T--M--P--W--G--N--P--G--D--H--H--D--F--E--P--Q--R--
AAGTTCCAGTGTATAGTATTTTTAAATATACCCAGATATTGTGCTGGCACAATGCCCTGGGGAAACCCAGGTGATCACCATGATTTCGAACCTCAGCGTC
:::::::::::::::::::::::::::::::::   :::::::: :::::::::::::::::.:::::::: :::::::::::.::.:::::::::::::
AAGTTCCAGTGTATAGTATTTTTAAATATACCC---TATTGTGCGGGCACAATGCCCTGGGGGAACCCAGGAGATCACCATGACTTTGAACCTCAGCGTC
-K--F--Q--C--I--V--F--L--N--I--P-----Y--C--A--G--T--M--P--W--G--N--P--G--D--H--H--D--F--E--P--Q--R--

-------------------------------------------------><-------------------------------------------------
H--D--D--G--Y--I--E--V--I--G--F--T--M--A--S--L--A--A--L--Q--V--G--G--H--G--E--R--L--H--Q--C--R--E--V
ATGATGATGGTTATATTGAAGTCATTGGATTTACCATGGCCTCTTTGGCAGCCCTGCAAGTTGGGGGCCATGGAGAGAGGCTACACCAGTGTCGAGAAGT
:::::::::::::::::::::::::::::::.::::::::::::::::: ::::::::::::::::::::.:::::.:::::.:::::::::::.::.::
ATGATGATGGTTATATTGAAGTCATTGGATTCACCATGGCCTCTTTGGCTGCCCTGCAAGTTGGGGGCCACGGAGAAAGGCTGCACCAGTGTCGGGAGGT
H--D--D--G--Y--I--E--V--I--G--F--T--M--A--S--L--A--A--L--Q--V--G--G--H--G--E--R--L--H--Q--C--R--E--V

----------------------------------------------------------------------------------------------------
--M--L--L--T--Y--K--S--I--P--M--Q--V--D--G--E--P--C--R--L--A--P--A--M--I--R--I--S--L--R--N--Q--A--N-
CATGCTTCTAACTTACAAATCCATCCCCATGCAAGTGGATGGGGAGCCCTGTAGGTTGGCCCCAGCTATGATTCGGATCTCCCTGAGGAATCAGGCCAAC
:::::: ::::: :::::.::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CATGCTGCTAACATACAAGTCCATCCCTATGCAAGTGGATGGGGAGCCCTGTAGGTTGGCCCCAGCTATGATTCGGATCTCCCTGAGGAATCAGGCCAAC
--M--L--L--T--Y--K--S--I--P--M--Q--V--D--G--E--P--C--R--L--A--P--A--M--I--R--I--S--L--R--N--Q--A--N-

-------------------------------------------------><-------------------------------------------------
-M--V--Q--K--S--K--R--R--T--S--M--P--L--L--N--D--P--Q--S--V--P--D--R--L--R--I--R--V--N--K--I--S--L--
ATGGTACAGAAGAGCAAGAGGAGAACATCCATGCCTTTACTCAATGATCCCCAGTCTGTCCCAGATCGTCTGAGGATCCGGGTGAACAAAATCAGTTTAC
::::::::::::::::::::::::::.:::::::::::::::      :::::::::::::::::.::.:::::::::::::::::::::::::::::::
ATGGTACAGAAGAGCAAGAGGAGAACGTCCATGCCTTTACTC------CCCCAGTCTGTCCCAGACCGCCTGAGGATCCGGGTGAACAAAATCAGTTTAC
-M--V--Q--K--S--K--R--R--T--S--M--P--L--L--------P--Q--S--V--P--D--R--L--R--I--R--V--N--K--I--S--L--

--------------------------------------------------><------------------------------------------------
Q--D--Y--E--G--F--H--Y--D--K--E--K--L--R--E--A--S--I--S--D--W--L--R--T--I--A--G--E--L--V--Q--S--F--G
AAGACTATGAAGGATTCCACTATGACAAGGAGAAACTCCGAGAAGCTTCTATTTCAGACTGGTTAAGAACCATTGCTGGGGAACTAGTGCAGTCATTTGG
::::::::::::::::::::::.:::::.:::::::::::.::::::                                                     
AAGACTATGAAGGATTCCACTACGACAAAGAGAAACTCCGGGAAGCT-----------------------------------------------------
Q--D--Y--E--G--F--H--Y--D--K--E--K--L--R--E--A------------------------------------------------------

----><------------------------------------------------------------------------------><--------------
--A--I--P--L--G--I--L--V--V--R--G--D--C--D--L--E--T--C--R--M--Y--I--D--R--L--Q--E--D--L--Q--S--V--S-
AGCGATACCTCTGGGTATTCTAGTTGTGCGTGGAGACTGTGATTTGGAGACTTGCCGTATGTACATAGACCGCCTACAGGAGGACCTACAGTCAGTTTCT
    :: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::: :::::::::::..:::::::::::
----ATCCCTCTGGGTATTCTAGTTGTGCGTGGAGACTGTGATTTGGAGACTTGCCGTATGTACATAGATCGCCTTCAGGAGGACCTGTAGTCAGTTTCT
-----I--P--L--G--I--L--V--V--R--G--D--C--D--L--E--T--C--R--M--Y--I--D--R--L--Q--E--D--L--*--S--V--S-

-----------------------------><-------------------------------------------------------------------->
-S--G--S--Q--R--V--H--Y--Q--D--H--E--T--S--F--P--R--A--L--S--A--Q--R--L--S--P--R--W--C--F--L--D--D--
TCTGGCTCCCAGAGAGTTCATTACCAGGACCATGAAACCTCCTTCCCCAGGGCTCTCTCAGCACAGAGGCTCTCTCCTCGGTGGTGCTTCCTAGATGACA
::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::: :::::.::.::.:: :::::::::::.::::::    
TCTGGCTCCCAGAGAGTTCATTACCAGGACCATGAAACCTCCTTCCCCAGGGCGCTCTCAGCTCAGAGACTTTCCCCACGGTGGTGCTTTCTAGAT----
-S--G--S--Q--R--V--H--Y--Q--D--H--E--T--S--F--P--R--A--L--S--A--Q--R--L--S--P--R--W--C--F--L--D-----

<---------><----------------------------------------------------------------------------------------
R--S--Q--E--H--L--H--F--V--M--E--I--S--Q--D--E--I--F--I--L--D--P--D--M--V--V--S--Q--P--A--G--T--P--P
GATCTCAGGAACATTTGCACTTTGTGATGGAGATTTCCCAAGATGAGATTTTTATTCTGGACCCAGATATGGTGGTGTCACAGCCGGCGGGGACACCTCC
        ::::::::.::::::::::::::::::::.:::::::::::::::::::::::::::::::::::: :::: :::: :::::::::::::::
--------GAACATTTACACTTTGTGATGGAGATTTCTCAAGATGAGATTTTTATTCTGGACCCAGATATGGTGTTGTCCCAGCAGGCGGGGACACCTCC
---------E--H--L--H--F--V--M--E--I--S--Q--D--E--I--F--I--L--D--P--D--M--V--L--S--Q--Q--A--G--T--P--P

--------------------------------------><------------------------------------------------------------
--G--M--P--D--L--V--V--E--Q--A--S--G--I--S--D--W--W--N--P--A--L--R--K--R--M--L--S--D--S--G--L--G--M-
GGGCATGCCTGACCTGGTGGTGGAACAAGCCTCGGGGATCTCAGACTGGTGGAATCCTGCCCTGCGGAAACGCATGCTGAGTGACAGTGGGCTGGGGATG
.:: ::::::::::::::::::::.::::::      ::  :::::::::::::::::::::: :: ::::::::::::::::::::.:: :::::::::
AGGAATGCCTGACCTGGTGGTGGAGCAAGCC------ATGACAGACTGGTGGAATCCTGCCCTCCGCAAACGCATGCTGAGTGACAGCGGCCTGGGGATG
--G--M--P--D--L--V--V--E--Q--A--------M--T--D--W--W--N--P--A--L--R--K--R--M--L--S--D--S--G--L--G--M-

-------------------------------------------------------------><------------------------><-----------
-I--A--P--Y--Y--E--D--S--D--L--K--D--L--S--H--S--R--V--L--Q--S--P--V--S--S--E--D--H--A--I--L--Q--A--
ATAGCTCCCTATTATGAGGACTCAGATCTGAAAGATCTCAGCCACTCCCGCGTGCTACAGTCACCAGTCTCTTCAGAAGATCATGCAATTTTGCAGGCAG
:: .:::: .:::::::.:::::.:::::::.::::.::::::::::::: :::                                 :::::::::::::
ATCACTCCGCATTATGAAGACTCGGATCTGAGAGATTTCAGCCACTCCCGAGTG---------------------------------ATTTTGCAGGCAG
-I--T--P--H--Y--E--D--S--D--L--R--D--F--S--H--S--R--V-----------------------------------I--L--Q--A--

-------------------------><-------------------------------------------------------------------------
V--I--A--G--D--L--M--K--L--I--E--S--Y--K--N--G--G--S--L--L--I--Q--G--P--D--H--C--S--L--L--H--Y--A--A
TAATAGCTGGTGATCTTATGAAGCTAATAGAAAGCTATAAAAATGGAGGCAGTCTGCTAATTCAGGGACCAGACCACTGTTCACTCCTTCACTACGCAGC
:::::::::::::::::::::::::::::::::::::::::::.::::::::.:::::::::::::::::::::::::::::::::::::::: ::::::
TAATAGCTGGTGATCTTATGAAGCTAATAGAAAGCTATAAAAACGGAGGCAGCCTGCTAATTCAGGGACCAGACCACTGTTCACTCCTTCACTTCGCAGC
V--I--A--G--D--L--M--K--L--I--E--S--Y--K--N--G--G--S--L--L--I--Q--G--P--D--H--C--S--L--L--H--F--A--A

----------------------------------------------><-----------------------------------><---------------
--K--T--G--N--G--E--I--V--K--Y--I--L--D--H--G--P--S--E--L--L--D--M--A--D--S--E--T--G--E--T--A--L--H-
TAAAACCGGCAACGGGGAGATTGTGAAATATATCCTTGACCACGGACCTTCCGAGTTATTGGATATGGCAGACAGTGAAACGGGTGAGACTGCACTGCAC
:::::::::::::::::::::::::::::::::::::::::::                                       : ::::::.:::::::::
TAAAACCGGCAACGGGGAGATTGTGAAATATATCCTTGACCAC---------------------------------------GTTGAGACCGCACTGCAC
--K--T--G--N--G--E--I--V--K--Y--I--L--D--H-----------------------------------------V--E--T--A--L--H-

-----------------------------------------------------------------------------------><---------------
-K--A--A--C--Q--R--N--R--A--V--C--Q--L--L--V--D--A--G--A--S--L--R--K--T--D--S--K--G--K--T--P--Q--E--
AAGGCTGCCTGCCAGCGGAACCGGGCTGTGTGCCAGCTTCTGGTGGATGCAGGAGCATCTCTGAGAAAGACGGACTCCAAGGGTAAGACACCTCAAGAAA
:::::.:::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::
AAGGCCGCCTGCCAGCGGAACCGGGCTGTGTGCCAGCTTCTGGTGGACGCAGGAGCATCTCTGAGAAAGACGGACTCCAAGGGTAAGACACCTCAAGAAA
-K--A--A--C--Q--R--N--R--A--V--C--Q--L--L--V--D--A--G--A--S--L--R--K--T--D--S--K--G--K--T--P--Q--E--

--------------------------------------------------------------------------------------------------
R--A--Q--Q--A--G--D--P--D--L--A--A--Y--L--E--S--R--Q--N--Y--K--V--I--G--H--E--D--L--E--T--A--V--*-
GAGCACAGCAGGCTGGGGACCCAGACTTGGCTGCTTACCTAGAAAGCCGTCAGAACTATAAGGTCATTGGCCATGAGGACCTGGAAACTGCTGTTTGA
::::::::::::: :::::::: ::.:::::::::::::::::::::::.::::::::::::.:::::::::::::::::::::::::::: ::::::
GAGCACAGCAGGCGGGGGACCCCGATTTGGCTGCTTACCTAGAAAGCCGCCAGAACTATAAGATCATTGGCCATGAGGACCTGGAAACTGCGGTTTGA
R--A--Q--Q--A--G--D--P--D--L--A--A--Y--L--E--S--R--Q--N--Y--K--I--I--G--H--E--D--L--E--T--A--V--*-

Pig Consensus Sequence

>BGISUST0000894295
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------AAACTGGCTCTCAGGAAGAAGTGTGCAGTCTGTAAAATtgTCCACAGTGCCTGCACTGAAAAGCTGGAAAAGATTAATTTCAGATGTAAACCAA
CATTTCGAGAAGGGGGCTCAAGATCTCCAAGAGAAAATTTTGTCCGTCATCACTGGGTGCACAGGCGTCGGCAGGAGGGAAAGTGTAAGCAGTGCGGTAA
G------------------------------------------------------------------------TTTCACAATAAGGTGACCTGCTTCATG
CTGCATCACATTGAGGAACCCTGCTCGCTGGGGGCTCATGCTGCTGTTATCGTCCCGCCCACCTGGATCATTAAGGTGAAGAAACCTCAGAACTCTCTGA
AGGCTTCCAATCGGAAGAAGAAGAGAACAAGCTTTAAAAGAAAAGCCAGTAAAAGAGGAACGGAACAGGAAAACAAAGGGCGTCCTTTTGTGATAAAACC
TATCTCTTCACCTCTCATGAAACCCTTGCTTGTGTTTGTGAACCCCAAGAGTGGAGGCAACCAG------------------------------------
------------------------------------------------CTTGAGTTGTATAGGAAAGTACCAAATCTGCGAATTCTGGCCTGTGGTGGGG
ATGGAACG--------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------------------------------------------------GCAGC
CTTTTCTGATTTTCTACAGAGAAGCTCTCGAGATCTATCCAAACATGTTAAAGTT---TGTGATGGAACAGATCTCACCCCAAAGATTCAGGAACTGAAG
TTCCAGTGTATAGTATTTTTAAATATACCC---TATTGTGCGGGCACAATGCCCTGGGGGAACCCAGGAGATCACCATGACTTTGAACCTCAGCGTCATG
ATGATGGTTATATTGAAGTCATTGGATTCACCATGGCCTCTTTGGCTGCCCTGCAAGTTGGGGGCCACGGAGAAAGGCTGCACCAGTGTCGGGAGGTCAT
GCTGCTAACATACAAGTCCATCCCTATGCAAGTGGATGGGGAGCCCTGTAGGTTGGCCCCAGCTATGATTCGGATCTCCCTGAGGAATCAGGCCAACATG
GTACAGAAGAGCAAGAGGAGAACGTCCATGCCTTTACTC------CCCCAGTCTGTCCCAGACCGCCTGAGGATCCGGGTGAACAAAATCAGTTTACAAG
ACTATGAAGGATTCCACTACGACAAAGAGAAACTCCGGGAAGCT--------------------------------------------------------
-ATCCCTCTGGGTATTCTAGTTGTGCGTGGAGACTGTGATTTGGAGACTTGCCGTATGTACATAGATCGCCTTCAGGAGGACCTGTAGTCAGTTTCTTCT
GGCTCCCAGAGAGTTCATTACCAGGACCATGAAACCTCCTTCCCCAGGGCGCTCTCAGCTCAGAGACTTTCCCCACGGTGGTGCTTTCTAGAT-------
-----GAACATTTACACTTTGTGATGGAGATTTCTCAAGATGAGATTTTTATTCTGGACCCAGATATGGTGTTGTCCCAGCAGGCGGGGACACCTCCAGG
AATGCCTGACCTGGTGGTGGAGCAAGCC------ATGACAGACTGGTGGAATCCTGCCCTCCGCAAACGCATGCTGAGTGACAGCGGCCTGGGGATGATC
ACTCCGCATTATGAAGACTCGGATCTGAGAGATTTCAGCCACTCCCGAGTG---------------------------------ATTTTGCAGGCAGTAA
TAGCTGGTGATCTTATGAAGCTAATAGAAAGCTATAAAAACGGAGGCAGCCTGCTAATTCAGGGACCAGACCACTGTTCACTCCTTCACTTCGCAGCTAA
AACCGGCAACGGGGAGATTGTGAAATATATCCTTGACCAC---------------------------------------GTTGAGACCGCACTGCACAAG
GCCGCCTGCCAGCGGAACCGGGCTGTGTGCCAGCTTCTGGTGGACGCAGGAGCATCTCTGAGAAAGACGGACTCCAAGGGTAAGACACCTCAAGAAAGAG
CACAGCAGGCGGGGGACCCCGATTTGGCTGCTTACCTAGAAAGCCGCCAGAACTATAAGATCATTGGCCATGAGGACCTGGAAACTGCGGTTTGA


>BGISUSP0000894295
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--KLALRKKCAVCKIVHSACTEKLEKINFRCKPTFREGGSRSPRENFVRHHWVHRRRQEGKCKQCGK------------------------FHNKVTCFM
LHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGTEQENKGRPFVIKPISSPLMKPLLVFVNPKSGGNQ------------
----------------LELYRKVPNLRILACGGDGT----------------------------------------------------------------
-----------------------------------------------------------------AAFSDFLQRSSRDLSKHVKV-CDGTDLTPKIQELK
FQCIVFLNIP-YCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGERLHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANM
VQKSKRRTSMPLL--PQSVPDRLRIRVNKISLQDYEGFHYDKEKLREA-------------------IPLGILVVRGDCDLETCRMYIDRLQEDL*SVSS
GSQRVHYQDHETSFPRALSAQRLSPRWCFLD----EHLHFVMEISQDEIFILDPDMVLSQQAGTPPGMPDLVVEQA--MTDWWNPALRKRMLSDSGLGMI
TPHYEDSDLRDFSHSRV-----------ILQAVIAGDLMKLIESYKNGGSLLIQGPDHCSLLHFAAKTGNGEIVKYILDH-------------VETALHK
AACQRNRAVCQLLVDAGASLRKTDSKGKTPQERAQQAGDPDLAAYLESRQNYKIIGHEDLETAV*