Sequences
EST Library Info
ecc1Foetus 50 days, cortex cerebri
eje2Foetus 50 days, jejunum
fce1Foetus 100 days, cerebellum
nca2Newborn 115 days, cartillage
pgl1Pituitary gland
relu1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000157778 (click for geneview)
Transcript ID ENST00000288607(link to ensembl)
Symbol NP_115678.1
Localtion Chromosome:7:1380213:1382870:-1 band: 7p22.3
Description hypothetical protein MGC10911
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--E--D--T--P--L--V--I--S--K--Q--K--T--E--V--V--C--G--V--P--T--Q--V--V--C--T--A--F--S--S--H--I--L--
ATGGAAGACACGCCGTTGGTGATATCGAAGCAGAAGACGGAGGTGGTGTGCGGGGTCCCCACCCAGGTGGTGTGTACGGCCTTCAGCAGTCACATCCTGG
:::::::::: .::..::::..:::: ::.::::::::.:::::.:::::.:: :::::.:::::::::::.::.::.::::::::::::::::::::::
ATGGAAGACAAACCACTGGTAGTATCTAAACAGAAGACAGAGGTAGTGTGTGGCGTCCCTACCCAGGTGGTATGCACAGCCTTCAGCAGTCACATCCTGG
-M--E--D--K--P--L--V--V--S--K--Q--K--T--E--V--V--C--G--V--P--T--Q--V--V--C--T--A--F--S--S--H--I--L--

----------------------------------------------------------------------------------------------------
V--V--V--T--Q--F--G--K--M--G--T--L--V--S--L--E--P--S--S--V--A--S--D--V--S--K--P--V--L--T--T--K--V--L
TGGTGGTGACCCAGTTTGGGAAGATGGGCACCCTGGTCTCCCTGGAGCCCAGCAGCGTGGCCAGTGACGTCAGCAAGCCTGTGCTCACCACAAAAGTCCT
:::::::::::::.::.:::::.:::::.:::::::::::::::::..::::::::.::.::::::::.:::::::::::::::::::::: ::::::::
TGGTGGTGACCCAATTCGGGAAAATGGGTACCCTGGTCTCCCTGGAATCCAGCAGCATGACCAGTGACATCAGCAAGCCTGTGCTCACCACCAAAGTCCT
V--V--V--T--Q--F--G--K--M--G--T--L--V--S--L--E--S--S--S--M--T--S--D--I--S--K--P--V--L--T--T--K--V--L

---------------><-----------------------------------------------------------------------------------
--L--G--Q--D--E--P--L--I--H--V--F--A--K--N--L--V--A--F--V--S--Q--E--A--G--N--R--A--V--L--L--A--V--A-
TCTGGGGCAGGATGAGCCTCTCATCCATGTCTTTGCAAAGAACCTGGTAGCGTTTGTGTCTCAAGAAGCTGGAAACAGAGCAGTCCTCCTCGCCGTGGCC
::: ::::::::.:::::::::::::::::::::::::::::::::::.:: :::::::::::.:::::::::::::::::::::::::::::: :::::
TCTCGGGCAGGACGAGCCTCTCATCCATGTCTTTGCAAAGAACCTGGTGGCCTTTGTGTCTCAGGAAGCTGGAAACAGAGCAGTCCTCCTCGCCTTGGCC
--L--G--Q--D--E--P--L--I--H--V--F--A--K--N--L--V--A--F--V--S--Q--E--A--G--N--R--A--V--L--L--A--L--A-

-------------------------------------------------------------------->
-V--K--D--K--S--M--E--G--L--K--A--L--R--E--V--I--R--V--C--Q--V--W--*-
GTGAAGGACAAAAGCATGGAGGGGCTGAAGGCGCTGAGGGAGGTGATCCGGGTGTGCCAGGTGTGGTGA
:::::::::::.:::::::::::. ::: ::: ::::.:::::::::::::..::::::::::::::::
GTGAAGGACAAGAGCATGGAGGGAGTGACGGCCCTGAAGGAGGTGATCCGGACGTGCCAGGTGTGGTGA
-V--K--D--K--S--M--E--G--V--T--A--L--K--E--V--I--R--T--C--Q--V--W--*-

Pig Consensus Sequence

>BGISUST0000899366
ATGGAAGACAAACCACTGGTAGTATCTAAACAGAAGACAGAGGTAGTGTGTGGCGTCCCTACCCAGGTGGTATGCACAGCCTTCAGCAGTCACATCCTGG
TGGTGGTGACCCAATTCGGGAAAATGGGTACCCTGGTCTCCCTGGAATCCAGCAGCATGACCAGTGACATCAGCAAGCCTGTGCTCACCACCAAAGTCCT
TCTCGGGCAGGACGAGCCTCTCATCCATGTCTTTGCAAAGAACCTGGTGGCCTTTGTGTCTCAGGAAGCTGGAAACAGAGCAGTCCTCCTCGCCTTGGCC
GTGAAGGACAAGAGCATGGAGGGAGTGACGGCCCTGAAGGAGGTGATCCGGACGTGCCAGGTGTGGTGA


>BGISUSP0000899366
MEDKPLVVSKQKTEVVCGVPTQVVCTAFSSHILVVVTQFGKMGTLVSLESSSMTSDISKPVLTTKVLLGQDEPLIHVFAKNLVAFVSQEAGNRAVLLALA
VKDKSMEGVTALKEVIRTCQVW*