Sequences
EST Library Info
pliv1Unavailable
sag1Salivary gland
tra1Trachea
Clusters
Oligos
SNPs

Gene ID ENSG00000157796 (click for geneview)
Transcript ID ENST00000288634(link to ensembl)
Symbol WDR19
Localtion Chromosome:4:39006590:39109995:1 band: 4p14
Description WD repeat domain 19 [Source:RefSeq_peptide;Acc:NP_079408]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----><------------------------------------------------------------------------------------------><-
-M--K--R--I--F--S--L--L--E--K--T--W--L--G--A--P--I--Q--F--A--W--Q--K--T--S--G--N--Y--L--A--V--T--G--
ATGAAGCGTATTTTCTCACTGCTAGAAAAGACTTGGCTTGGCGCACCAATACAGTTTGCCTGGCAAAAAACATCAGGAAACTACCTTGCAGTAACAGGAG
      :::.::::: ::::::: ::::::::::::::::::.::::::::..::::.::::::::::::::::::::::::::::::::::::::   :
------CGTGTTTTCACACTGCTCGAAAAGACTTGGCTTGGCACACCAATATGGTTTACCTGGCAAAAAACATCAGGAAACTACCTTGCAGTAACA---G
-------R--V--F--T--L--L--E--K--T--W--L--G--T--P--I--W--F--T--W--Q--K--T--S--G--N--Y--L--A--V--T-----

---------------------------------------------------------------><-----------------------------------
A--D--Y--I--V--K--I--F--D--R--H--G--Q--K--R--S--E--I--N--L--P--G--N--C--V--A--M--D--W--D--K--D--G--D
CTGATTATATTGTGAAAATCTTTGATCGCCATGGTCAAAAAAGAAGTGAAATTAACTTACCTGGTAACTGTGTTGCCATGGATTGGGATAAAGATGGAGA
:::::.:.:::::::::::::::::::::::::::::: ::::::::::::::::::::      ::::::::.::.:::::.:::::::::::::::::
CTGATCACATTGTGAAAATCTTTGATCGCCATGGTCAACAAAGAAGTGAAATTAACTTA------AACTGTGTCGCTATGGACTGGGATAAAGATGGAGA
A--D--H--I--V--K--I--F--D--R--H--G--Q--Q--R--S--E--I--N--L--------N--C--V--A--M--D--W--D--K--D--G--D

-----------------------------------------------------------------------------------------><---------
--V--L--A--V--I--A--E--K--S--S--C--I--Y--L--W--D--A--N--T--N--K--T--S--Q--L--D--N--G--M--R--D--Q--M-
TGTCCTAGCAGTGATTGCTGAGAAATCTAGCTGCATTTATCTTTGGGATGCCAACACAAATAAGACCAGCCAGTTAGACAATGGCATGAGGGATCAAATG
:.:::::::::::::::::::::::::.::.:.::::::::: :::::::::::::::::::::::::::::::::::::.:::::::            
TATCCTAGCAGTGATTGCTGAGAAATCCAGTTACATTTATCTATGGGATGCCAACACAAATAAGACCAGCCAGTTAGACAGTGGCATG------------
--I--L--A--V--I--A--E--K--S--S--Y--I--Y--L--W--D--A--N--T--N--K--T--S--Q--L--D--S--G--M-------------

----------------------------------------------------------------------------------------------------
-S--F--L--L--W--S--K--V--G--S--F--L--A--V--G--T--V--K--G--N--L--L--I--Y--N--H--Q--T--S--R--K--I--P--
TCTTTCCTTCTTTGGTCAAAAGTTGGAAGTTTCCTGGCTGTTGGAACTGTTAAAGGAAATTTGCTTATTTATAATCATCAGACATCTCGAAAGATTCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----><---------------------------------------------------------------------------------------------
V--L--G--K--H--T--K--R--I--T--C--G--C--W--N--A--E--N--L--L--A--L--G--G--E--D--K--M--I--T--V--S--N--Q
TCCTTGGAAAACATACTAAGAGAATCACTTGTGGATGTTGGAATGCAGAAAATCTGCTTGCTTTAGGTGGTGAAGATAAAATGATTACAGTTAGTAATCA
        :::::::::::::::::::: :::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::
--------AAACATACTAAGAGAATCACATGTGGATGTTGGAATGCAGAAAATATGCTTGCTTTAGGTGGTGAAGATAAAATGATTACAGTTAGTAATCA
---------K--H--T--K--R--I--T--C--G--C--W--N--A--E--N--M--L--A--L--G--G--E--D--K--M--I--T--V--S--N--Q

---------------------><-----------------------------------------------------------------------------
--E--G--D--T--I--R--Q--T--Q--V--R--S--E--P--S--N--M--Q--F--F--L--M--K--M--D--D--R--T--S--A--A--E--S-
GGAAGGTGACACGATAAGACAGACACAAGTGAGATCAGAGCCTAGCAACATGCAGTTTTTCTTGATGAAGATGGATGACCGAACCTCTGCTGCTGAAAGC
:::::::::::::::::::::::::: .::::::::::::::.:::.::::::::::::.: :::::::::. ::::::::.::::::::.:::::::::
GGAAGGTGACACGATAAGACAGACACCGGTGAGATCAGAGCCCAGCGACATGCAGTTTTCCATGATGAAGACTGATGACCGGACCTCTGCCGCTGAAAGC
--E--G--D--T--I--R--Q--T--P--V--R--S--E--P--S--D--M--Q--F--S--M--M--K--T--D--D--R--T--S--A--A--E--S-

--><------------------------------------------------------------------------------------------------
-M--I--S--V--V--L--G--K--K--T--L--F--F--L--N--L--N--E--P--D--N--P--A--D--L--E--F--Q--Q--D--F--G--N--
ATGATAAGTGTGGTGCTTGGCAAGAAAACTTTGTTTTTTTTAAATCTGAATGAACCAGATAACCCAGCTGATCTTGAATTTCAGCAGGACTTTGGCAACA
   ::::::::.::  ::::::::::::::::::::.:::: :::::::.:::::::::.::::::..:::::: ::.::::::::: : : ::::::::
---ATAAGTGTAGTTGTTGGCAAGAAAACTTTGTTTCTTTTTAATCTGAGTGAACCAGACAACCCAATTGATCTGGAGTTTCAGCAGCAGTATGGCAACA
----I--S--V--V--V--G--K--K--T--L--F--L--F--N--L--S--E--P--D--N--P--I--D--L--E--F--Q--Q--Q--Y--G--N--

---------------><-----------------------------------------------------------------------------------
I--V--C--Y--N--W--Y--G--D--G--R--I--M--I--G--F--S--C--G--H--F--V--V--I--S--T--H--T--G--E--L--G--Q--E
TTGTCTGCTATAATTGGTATGGTGATGGCCGCATCATGATTGGTTTTTCATGTGGACATTTTGTGGTCATTTCTACTCATACTGGAGAGCTTGGTCAAGA
::::::::::::.:   ::::::::::::...::::::::::::::::::.::::   :::::::::::::::.::::::..: ::::: :.::::::::
TTGTCTGCTATAGT---TATGGTGATGGCTATATCATGATTGGTTTTTCACGTGGCATTTTTGTGGTCATTTCCACTCATGTTCGAGAGATCGGTCAAGA
I--V--C--Y--S-----Y--G--D--G--Y--I--M--I--G--F--S--R--G--I--F--V--V--I--S--T--H--V--R--E--I--G--Q--E

--------------------------------------------------------------------------------------------><------
--I--F--Q--A--R--N--H--K--D--N--L--T--S--I--A--V--S--Q--T--L--N--K--V--A--T--C--G--D--N--C--I--K--I-
GATATTTCAGGCTCGTAACCATAAAGATAATCTAACCAGCATTGCAGTATCACAGACTCTTAACAAAGTTGCTACATGTGGAGATAACTGCATTAAAATC
::::::::::::::::.:.:::::.::::.::: :::::.::::: :::::::::::.::::::::. : ::::::::::: ::::::   :::::::::
GATATTTCAGGCTCGTGATCATAAGGATAGTCTCACCAGTATTGCTGTATCACAGACCCTTAACAAGCT-GCTACATGTGGTGATAAC---ATTAAAATC
--I--F--Q--A--R--D--H--K--D--S--L--T--S--I--A--V--S--Q--T--L--N--K--L--A--T--C--G--D--N-----I--K--I-

---------------------------------------------------------------><-----------------------------------
-Q--D--L--V--D--L--K--D--M--Y--V--I--L--N--L--D--E--E--N--K--G--L--G--T--L--S--W--T--D--D--G--Q--L--
CAAGACTTGGTTGACTTAAAAGACATGTATGTTATACTCAACCTGGATGAGGAAAATAAAGGATTGGGTACCTTGTCCTGGACTGATGATGGCCAGTTGC
:: :::::::. :::::::::::::::::::.:::  ::::::::::::: :::::::::   :::::.:::::::::::::: :: :::::::::::::
CATGACTTGGCAGACTTAAAAGACATGTATGCTATCATCAACCTGGATGATGAAAATAAA---TTGGGCACCTTGTCCTGGACAGAGGATGGCCAGTTGC
-H--D--L--A--D--L--K--D--M--Y--A--I--I--N--L--D--D--E--N--K-----L--G--T--L--S--W--T--E--D--G--Q--L--

----------------------------------------------------------------------------------------------------
L--A--L--S--T--Q--R--G--S--L--H--V--F--L--T--K--L--P--I--L--G--D--A--C--S--T--R--I--A--Y--L--T--S--L
TAGCACTCTCTACCCAAAGGGGCTCACTTCATGTTTTCCTGACCAAGCTTCCCATACTTGGGGATGCCTGCAGCACAAGGATTGCCTATCTCACCTCCCT
:.:::::.::::::::.:: :::::.::.::.:::::::::::::::::.::::: :: :: :::::::::::::: :::::::: ::::::::::::::
TGGCACTTTCTACCCAGAGCGGCTCGCTCCACGTTTTCCTGACCAAGCTCCCCATCCTGGGCGATGCCTGCAGCACCAGGATTGCGTATCTCACCTCCCT
L--A--L--S--T--Q--S--G--S--L--H--V--F--L--T--K--L--P--I--L--G--D--A--C--S--T--R--I--A--Y--L--T--S--L

------------------------------------><--------------------------------------------------------------
--L--E--V--T--V--A--N--P--V--E--G--E--L--P--I--T--V--S--V--D--V--E--P--N--F--V--A--V--G--L--Y--H--L-
CCTTGAAGTCACCGTAGCCAACCCTGTTGAAGGAGAGCTACCAATCACAGTTTCTGTTGATGTGGAACCCAACTTTGTGGCAGTAGGTCTTTATCATCTG
:::.::::::::.::.:::                                                                                 
CCTCGAAGTCACTGTGGCC---------------------------------------------------------------------------------
--L--E--V--T--V--A----------------------------------------------------------------------------------

--------------------------------------------------><------------------------------------------------
-A--V--G--M--N--N--R--A--W--F--Y--V--L--G--E--N--V--K--K--L--K--D--M--E--Y--L--G--T--V--A--S--I--C--
GCTGTAGGAATGAATAATCGAGCTTGGTTTTATGTCCTTGGAGAAAATGTGAAAAAATTGAAAGATATGGAGTATCTGGGAACAGTAGCCAGTATTTGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------><-------------------------------------------
L--H--S--D--Y--A--A--A--L--F--E--G--K--V--Q--L--H--L--I--E--S--E--I--L--D--A--Q--E--E--R--E--T--R--L
TTCATTCTGACTATGCTGCTGCACTTTTTGAAGGCAAAGTCCAGTTACATTTGATAGAAAGCGAAATCTTGGATGCTCAAGAAGAACGTGAGACTCGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------><--------------------
--F--P--A--V--D--D--K--C--R--I--L--C--H--A--L--T--S--D--F--L--I--Y--G--T--D--T--G--V--V--Q--Y--F--Y-
TTTCCCAGCAGTGGATGATAAGTGCCGTATCTTATGCCATGCCTTAACTAGTGATTTCCTCATCTATGGTACAGATACTGGTGTCGTTCAGTATTTCTAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-I--E--D--W--Q--F--V--N--D--Y--R--H--P--V--S--V--K--K--I--F--P--D--P--N--G--T--R--L--V--F--I--D--E--
ATTGAAGACTGGCAATTCGTTAATGATTATCGACATCCTGTCAGTGTGAAAAAGATTTTTCCCGACCCAAATGGGACCAGATTAGTTTTCATTGATGAAA
                                             :::::::::::::::::.:::::::::::::::::::::::.:::::::::::::
---------------------------------------------GTGAAAAAGATTTTTCCTGACCCAAATGGGACCAGATTAGTCTTCATTGATGAAA
----------------------------------------------V--K--K--I--F--P--D--P--N--G--T--R--L--V--F--I--D--E--

----------------------------><----------------------------------------------------------------------
K--S--D--G--F--V--Y--C--P--V--N--D--A--T--Y--E--I--P--D--F--S--P--T--I--K--G--V--L--W--E--N--W--P--M
AAAGTGATGGATTTGTTTACTGTCCAGTCAATGACGCTACCTATGAGATTCCAGATTTTTCACCAACCATTAAAGGTGTTCTTTGGGAAAACTGGCCAAT
::::::: ::::::::.::::::                                                                             
AAAGTGAGGGATTTGTCTACTGT-----------------------------------------------------------------------------
K--S--E--G--F--V--Y--C------------------------------------------------------------------------------

----------------------------------------------------------------------------><----------------------
--D--K--G--V--F--I--A--Y--D--D--D--K--V--Y--T--Y--V--F--H--K--D--T--I--Q--G--A--K--V--I--L--A--G--S-
GGATAAAGGTGTATTTATTGCTTATGATGATGATAAGGTGTACACTTATGTCTTTCACAAGGACACTATACAAGGAGCCAAGGTTATTTTGGCTGGTAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-T--K--V--P--F--A--H--K--P--L--L--L--Y--N--G--E--L--T--C--Q--T--Q--S--G--K--V--N--N--I--Y--L--S--T--
ACCAAAGTTCCTTTTGCTCATAAACCTTTGCTGCTATATAATGGAGAGCTGACCTGCCAAACACAGAGTGGAAAAGTAAACAACATCTACCTTAGCACCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------------><-----------------
H--G--F--L--S--N--L--K--D--T--G--P--D--E--L--R--P--M--L--A--Q--N--L--M--L--K--R--F--S--D--A--W--E--M
ATGGCTTTCTCAGCAACTTAAAAGATACGGGGCCTGACGAACTGAGACCAATGCTGGCACAGAATTTAATGCTAAAGAGGTTTTCTGATGCTTGGGAAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--C--R--I--L--N--D--E--A--A--W--N--E--L--A--R--A--C--L--H--H--M--E--V--E--F--A--I--R--V--Y--R--R--I-
GTGCAGGATTCTGAATGATGAGGCTGCCTGGAATGAGTTGGCCAGAGCTTGTCTACATCACATGGAAGTGGAGTTTGCAATCCGTGTTTATCGGAGAATT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------><---------------------------------------------------------
-G--N--V--G--I--V--M--S--L--E--Q--I--K--G--I--E--D--Y--N--L--L--A--G--H--L--A--M--F--T--N--D--Y--N--
GGAAATGTTGGCATAGTGATGTCCTTGGAACAAATAAAGGGAATAGAGGACTACAATCTTTTGGCAGGACACCTTGCCATGTTTACCAACGATTATAACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------><----------------------------------------------
L--A--Q--D--L--Y--L--A--S--S--C--P--I--A--A--L--E--M--R--R--D--L--Q--H--W--D--S--A--L--Q--L--A--K--H
TGGCTCAGGACTTGTACCTTGCATCCAGCTGTCCTATTGCTGCCCTGGAGATGAGAAGGGATTTACAGCATTGGGACAGTGCTCTACAACTGGCAAAGCA
                                                        ::::::::::::::.:::::::::::::::::.::::::::::.
--------------------------------------------------------AGGGATTTACAGCACTGGGACAGTGCTCTACAGCTGGCAAAGCG
---------------------------------------------------------R--D--L--Q--H--W--D--S--A--L--Q--L--A--K--R

--------------------------------------------------------------><------------------------------------
--L--A--P--D--Q--I--P--F--I--S--K--E--Y--A--I--Q--L--E--F--A--G--D--Y--V--N--A--L--A--H--Y--E--K--G-
TTTGGCCCCAGACCAGATACCTTTTATATCAAAAGAATATGCTATTCAGCTTGAATTCGCGGGTGATTATGTAAATGCTTTGGCTCATTATGAGAAAGGA
:::.::::::::::::::::: ::::::::::::::::::::::::::::::::::::   ::::::::::::::::: :::::::::::::::::::::
TTTAGCCCCAGACCAGATACCGTTTATATCAAAAGAATATGCTATTCAGCTTGAATTC---GGTGATTATGTAAATGCATTGGCTCATTATGAGAAAGGA
--L--A--P--D--Q--I--P--F--I--S--K--E--Y--A--I--Q--L--E--F-----G--D--Y--V--N--A--L--A--H--Y--E--K--G-

--------------------><------------------------------------------------------------------------------
-I--T--G--D--N--K--E--H--D--E--A--C--L--A--G--V--A--Q--M--S--I--R--M--G--D--I--R--R--G--V--N--Q--A--
ATAACAGGTGATAATAAGGAACATGATGAAGCTTGTCTGGCTGGAGTGGCCCAGATGTCCATAAGAATGGGAGACATACGTCGAGGGGTTAACCAAGCCC
::::::::::::::::::::.::::::::.:. ::::::::.:: .: ::::::::::::::::::::::::::::: ::.::::::::::.:::.:: :
ATAACAGGTGATAATAAGGAGCATGATGAGGTGTGTCTGGCCGGCATCGCCCAGATGTCCATAAGAATGGGAGACATCCGCCGAGGGGTTAGCCAGGCGC
-I--T--G--D--N--K--E--H--D--E--V--C--L--A--G--I--A--Q--M--S--I--R--M--G--D--I--R--R--G--V--S--Q--A--

-------------------------------------------------------------><-------------------------------------
L--K--H--P--S--R--V--L--K--R--D--C--G--A--I--L--E--N--M--K--Q--F--S--E--A--A--Q--L--Y--E--K--G--L--Y
TCAAGCATCCCAGCAGGGTCCTTAAAAGAGACTGTGGAGCCATATTGGAGAATATGAAGCAATTTTCAGAAGCGGCCCAACTGTATGAAAAAGGTCTCTA
::::.:::::::::::::::::::::::::::::::: ::::: .::::::::::::::::::::::::::::.::.::.::::::::::::::::::::
TCAAACATCCCAGCAGGGTCCTTAAAAGAGACTGTGGTGCCATCCTGGAGAATATGAAGCAATTTTCAGAAGCAGCTCAGCTGTATGAAAAAGGTCTCTA
L--K--H--P--S--R--V--L--K--R--D--C--G--A--I--L--E--N--M--K--Q--F--S--E--A--A--Q--L--Y--E--K--G--L--Y

--------------------------------------------><------------------------------------------------------
--Y--D--K--A--A--S--V--Y--I--R--S--K--N--W--A--K--V--G--D--L--L--P--H--V--S--S--P--K--I--H--L--Q--Y-
CTACGATAAAGCAGCATCTGTTTACATCCGCTCTAAGAATTGGGCAAAAGTTGGTGATCTTCTGCCCCACGTTTCTTCTCCTAAGATCCATTTGCAGTAT
:::.::.::::::::::::::::::::::::: :::::::   :::::::::::::: ::::::::.::::: :::::::: :::::.::.::::::: :
CTATGACAAAGCAGCATCTGTTTACATCCGCTGTAAGAAT---GCAAAAGTTGGTGAGCTTCTGCCTCACGTGTCTTCTCCAAAGATTCACTTGCAGTTT
--Y--D--K--A--A--S--V--Y--I--R--C--K--N-----A--K--V--G--E--L--L--P--H--V--S--S--P--K--I--H--L--Q--F-

----------------------------><----------------------------------------------------------------------
-A--K--A--K--E--A--D--G--R--Y--K--E--A--V--V--A--Y--E--N--A--K--Q--W--Q--S--V--I--R--I--Y--L--D--H--
GCCAAAGCCAAGGAAGCAGATGGAAGATACAAAGAAGCTGTTGTAGCTTATGAAAATGCAAAACAGTGGCAAAGTGTAATCCGCATCTATCTGGATCACC
::::::::.:::::::::::::::   :::::::::::.:::::.::::::::.::::::::.:::::: : ::::::::.::::::::.::::::::::
GCCAAAGCTAAGGAAGCAGATGGA---TACAAAGAAGCCGTTGTGGCTTATGAGAATGCAAAGCAGTGGAACAGTGTAATTCGCATCTACCTGGATCACC
-A--K--A--K--E--A--D--G-----Y--K--E--A--V--V--A--Y--E--N--A--K--Q--W--N--S--V--I--R--I--Y--L--D--H--

---------------------------------------------------------------------------><-----------------------
L--N--N--P--E--K--A--V--N--I--V--R--E--T--Q--S--L--D--G--A--K--M--V--A--R--F--F--L--Q--L--G--D--Y--G
TCAATAATCCTGAAAAAGCTGTCAATATTGTTAGAGAGACCCAGTCTCTGGATGGAGCCAAAATGGTAGCCAGGTTTTTTCTACAGCTTGGTGACTATGG
::::.:::::.:::::.:::::::. :::::.::::::::::::::.::::::::::::::::::::::::   :::::::: ::::: :::::::::::
TCAACAATCCCGAAAAGGCTGTCAGGATTGTCAGAGAGACCCAGTCCCTGGATGGAGCCAAAATGGTAGCC---TTTTTTCTCCAGCTAGGTGACTATGG
L--N--N--P--E--K--A--V--R--I--V--R--E--T--Q--S--L--D--G--A--K--M--V--A-----F--F--L--Q--L--G--D--Y--G

----------------------------------------------------------------------------------------------------
--S--A--I--Q--F--L--V--M--S--K--C--N--N--E--A--F--T--L--A--Q--Q--H--N--K--M--E--I--Y--A--D--I--I--G-
GTCTGCCATCCAGTTTCTTGTCATGTCCAAATGCAACAATGAAGCTTTCACACTGGCTCAGCAACACAACAAAATGGAAATCTATGCAGATATTATTGGT
:::::::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::::::::::::::::::::::::::..:::.:::::   
GTCTGCCATCCAGTTTCTTGTCATGTCCAAATGTAATAATGAAGCTTTCACACTGGCTCAGCAACACAACAAAATGGAAATCTATGTGGATGTTATT---
--S--A--I--Q--F--L--V--M--S--K--C--N--N--E--A--F--T--L--A--Q--Q--H--N--K--M--E--I--Y--V--D--V--I----

><--------------------------------------------------------------------------------------------------
-S--E--D--T--T--N--E--D--Y--Q--S--I--A--L--Y--F--E--G--E--K--R--Y--L--Q--A--G--K--F--F--L--L--C--G--
TCTGAAGACACTACTAATGAAGACTATCAAAGCATTGCCTTATACTTTGAAGGAGAAAAGAGATATCTTCAGGCTGGAAAATTCTTCTTGCTGTGTGGCC
::::.:::::::::::::::.::.::::::::::::::::::::.::::::::::::::.:::.::.:::::::::::::::::::::::::.:::::::
TCTGGAGACACTACTAATGAGGATTATCAAAGCATTGCCTTATATTTTGAAGGAGAAAAAAGACATTTTCAGGCTGGAAAATTCTTCTTGCTATGTGGCC
-S--G--D--T--T--N--E--D--Y--Q--S--I--A--L--Y--F--E--G--E--K--R--H--F--Q--A--G--K--F--F--L--L--C--G--

-------------><-------------------------------------------------------------------><----------------
Q--Y--S--R--A--L--K--H--F--L--K--C--P--S--S--E--D--N--V--A--I--E--M--A--I--E--T--V--G--Q--A--K--D--E
AATATTCACGAGCACTTAAACACTTCCTGAAATGCCCAAGCTCGGAAGATAATGTGGCAATAGAAATGGCAATTGAAACTGTTGGTCAGGCCAAAGATGA
:.::: ::::::::::::::::::::.:::::::.::::.:::.::::::::::. ::: ::::::::::::::::::::::::::::.:::::.:::::
AGTATGCACGAGCACTTAAACACTTCTTGAAATGTCCAAACTCAGAAGATAATGCTGCATTAGAAATGGCAATTGAAACTGTTGGTCAAGCCAAGGATGA
Q--Y--A--R--A--L--K--H--F--L--K--C--P--N--S--E--D--N--A--A--L--E--M--A--I--E--T--V--G--Q--A--K--D--D

------------------------------------------------------------><--------------------------------------
--L--L--T--N--Q--L--I--D--H--L--L--G--E--N--D--G--M--P--K--D--A--K--Y--L--F--R--L--Y--M--A--L--K--Q-
ACTGCTGACCAATCAGCTGATAGACCATCTCCTGGGGGAGAACGATGGCATGCCTAAGGATGCCAAGTACCTGTTCCGCTTGTACATGGCTCTGAAGCAA
  :::::::::.:::::::::::::::.::. :::::::::..::::::::::: ::::::::::::::::::::::::::::::::::: ::::::::.
CGTGCTGACCAGTCAGCTGATAGACCACCTTATGGGGGAGAGTGATGGCATGCCGAAGGATGCCAAGTACCTGTTCCGCTTGTACATGGCACTGAAGCAG
--V--L--T--S--Q--L--I--D--H--L--M--G--E--S--D--G--M--P--K--D--A--K--Y--L--F--R--L--Y--M--A--L--K--Q-

---------------------------------------------------------><-----------------------------------------
-Y--R--E--A--A--Q--T--A--I--I--I--A--R--E--E--Q--S--A--G--N--Y--R--N--A--H--D--V--L--F--S--M--Y--A--
TACCGAGAAGCTGCCCAGACTGCCATCATCATTGCCAGAGAAGAGCAGTCTGCAGGCAACTACCGGAATGCACACGATGTTCTCTTCAGTATGTATGCAG
::::::::.::.:: :. ::.:::::::::::.:::::.:::::::::::::::   :::::.:::::.:::::.::.:::::::::::.:::::.::.:
TACCGAGAGGCCGCGCGCACCGCCATCATCATCGCCAGGGAAGAGCAGTCTGCA---AACTATCGGAACGCACATGACGTTCTCTTCAGCATGTACGCGG
-Y--R--E--A--A--R--T--A--I--I--I--A--R--E--E--Q--S--A-----N--Y--R--N--A--H--D--V--L--F--S--M--Y--A--

----------------------------------------------------------------------------------><----------------
E--L--K--S--Q--K--I--K--I--P--S--E--M--A--T--N--L--M--I--L--H--S--Y--I--L--V--K--I--H--V--K--N--G--D
AACTGAAATCCCAGAAGATCAAAATTCCCTCCGAGATGGCCACCAACCTCATGATTCTGCACAGCTATATACTAGTAAAGATTCATGTTAAAAATGGAGA
:::::::: :::::::::::::.::.::::::::::::::::::::::::::::::::::::::.::.:: ::.::.:::::::::::::::::::::::
AACTGAAAGCCCAGAAGATCAAGATCCCCTCCGAGATGGCCACCAACCTCATGATTCTGCACAGTTACATCCTGGTGAAGATTCATGTTAAAAATGGAGA
E--L--K--A--Q--K--I--K--I--P--S--E--M--A--T--N--L--M--I--L--H--S--Y--I--L--V--K--I--H--V--K--N--G--D

----------------------------------------------------------------------><----------------------------
--H--M--K--G--A--R--M--L--I--R--V--A--N--N--I--S--K--F--P--S--H--I--V--P--I--L--T--S--T--V--I--E--C-
TCACATGAAAGGGGCTCGCATGCTCATTCGGGTGGCCAACAACATCAGCAAATTTCCATCACACATTGTACCCATCCTGACGTCAACTGTGATTGAGTGT
:::.::::::::::: ::.:::::.::.:::::::::::::  :::::::: :::::.:::   ::.::.:::::::::::::: ::::: ::.::::::
TCATATGAAAGGGGCGCGTATGCTTATCCGGGTGGCCAACAT-ATCAGCAA-TTTCCGTCA---ATCGTGCCCATCCTGACGTCCACTGTCATCGAGTGT
--H--M--K--G--A--R--M--L--I--R--V--A--N--N--I--S--K--F--P--S-----I--V--P--I--L--T--S--T--V--I--E--C-

----------------------------------------------------------------------------------------------------
-H--R--A--G--L--K--N--S--A--F--S--F--A--A--M--L--M--R--P--E--Y--R--S--K--I--D--A--K--Y--K--K--K--I--
CACAGGGCAGGCCTGAAGAACTCTGCTTTCAGCTTCGCAGCTATGTTGATGAGGCCTGAATACCGCAGCAAAATAGATGCCAAATACAAAAAGAAGATCG
:::::::: :::::::::::::::::.::::::::.:::::.:.::::::: ::::.::.:::::::.:::.::::::::::::::::::::::::::.:
CACAGGGCTGGCCTGAAGAACTCTGCCTTCAGCTTTGCAGCCACGTTGATGCGGCCCGAGTACCGCAACAAGATAGATGCCAAATACAAAAAGAAGATTG
-H--R--A--G--L--K--N--S--A--F--S--F--A--A--T--L--M--R--P--E--Y--R--N--K--I--D--A--K--Y--K--K--K--I--

---------------------><-----------------------------------------------------------------------------
E--G--M--V--R--R--P--D--I--S--E--I--E--E--A--T--T--P--C--P--F--C--K--F--L--L--P--E--C--E--L--L--C--P
AGGGAATGGTCAGGAGACCCGATATATCTGAGATAGAAGAGGCCACGACTCCATGTCCATTCTGCAAATTTCTTCTCCCAGAGTGTGAACTCCTCTGTCC
::: :::::::   :::::.::::.:::.::::.:::::::::::: ::.::.::.:::::::::.:::::::::::::::::::.::::::::::::::
AGGCAATGGTC---AGACCTGATACATCCGAGACAGAAGAGGCCACCACCCCGTGCCCATTCTGCGAATTTCTTCTCCCAGAGTGCGAACTCCTCTGTCC
E--A--M--V-----R--P--D--T--S--E--T--E--E--A--T--T--P--C--P--F--C--E--F--L--L--P--E--C--E--L--L--C--P

---------------------------------------------><-----------------------------------------------------
--G--C--K--N--S--I--P--Y--C--I--A--T--G--R--H--M--L--K--D--D--W--T--V--C--P--H--C--D--F--P--A--L--Y-
TGGATGTAAAAACAGTATCCCATATTGCATTGCAACAGGTCGACACATGTTGAAAGATGACTGGACGGTGTGTCCACATTGTGACTTCCCTGCTCTATAC
::::::::::::.:..::::::::::::::.::::::::::::::::::.::::.:::::::::::::::::::::::.:::::::::::::::.:.:::
TGGATGTAAAAATAACATCCCATATTGCATCGCAACAGGTCGACACATGCTGAAGGATGACTGGACGGTGTGTCCACACTGTGACTTCCCTGCTTTGTAC
--G--C--K--N--N--I--P--Y--C--I--A--T--G--R--H--M--L--K--D--D--W--T--V--C--P--H--C--D--F--P--A--L--Y-

----------------------><----------------------------------------------------------------------------
-S--E--L--K--I--M--L--N--T--E--S--T--C--P--M--C--S--E--R--L--N--A--A--Q--L--K--K--I--S--D--C--T--Q--
TCAGAATTGAAGATCATGCTAAACACTGAAAGCACATGTCCTATGTGTTCAGAAAGATTAAACGCTGCTCAGCTGAAAAAGATTTCAGACTGTACCCAGT
:::::::: :::   :::.::::::::::.:: :::::::::::::::::::::::::::::: . :::::.:::::.::.::.:::::::..:::::::
TCAGAATTCAAG---ATGTTAAACACTGAGAGAACATGTCCTATGTGTTCAGAAAGATTAAACTTGGCTCAACTGAAGAAAATCTCAGACTACACCCAGT
-S--E--F--K-----M--L--N--T--E--R--T--C--P--M--C--S--E--R--L--N--L--A--Q--L--K--K--I--S--D--Y--T--Q--

--------------------------
Y--L--R--T--E--E--E--L--*-
ACCTGCGAACGGAGGAGGAACTGTGA
::::::..::.::.: :::.: ::::
ACCTGCAGACAGAAGTGGAGCAGTGA
Y--L--Q--T--E--V--E--Q--*-

Pig Consensus Sequence

>BGISUST0000883227
------CGTGTTTTCACACTGCTCGAAAAGACTTGGCTTGGCACACCAATATGGTTTACCTGGCAAAAAACATCAGGAAACTACCTTGCAGTAACA---G
CTGATCACATTGTGAAAATCTTTGATCGCCATGGTCAACAAAGAAGTGAAATTAACTTA------AACTGTGTCGCTATGGACTGGGATAAAGATGGAGA
TATCCTAGCAGTGATTGCTGAGAAATCCAGTTACATTTATCTATGGGATGCCAACACAAATAAGACCAGCCAGTTAGACAGTGGCATG------------
----------------------------------------------------------------------------------------------------
--------AAACATACTAAGAGAATCACATGTGGATGTTGGAATGCAGAAAATATGCTTGCTTTAGGTGGTGAAGATAAAATGATTACAGTTAGTAATCA
GGAAGGTGACACGATAAGACAGACACCGGTGAGATCAGAGCCCAGCGACATGCAGTTTTCCATGATGAAGACTGATGACCGGACCTCTGCCGCTGAAAGC
---ATAAGTGTAGTTGTTGGCAAGAAAACTTTGTTTCTTTTTAATCTGAGTGAACCAGACAACCCAATTGATCTGGAGTTTCAGCAGCAGTATGGCAACA
TTGTCTGCTATAGT---TATGGTGATGGCTATATCATGATTGGTTTTTCACGTGGCATTTTTGTGGTCATTTCCACTCATGTTCGAGAGATCGGTCAAGA
GATATTTCAGGCTCGTGATCATAAGGATAGTCTCACCAGTATTGCTGTATCACAGACCCTTAACAAggCTACATGTGGTGATAAC---ATTAAAATCCAT
GACTTGGCAGACTTAAAAGACATGTATGCTATCATCAACCTGGATGATGAAAATAAA---TTGGGCACCTTGTCCTGGACAGAGGATGGCCAGTTGCTGG
CACTTTCTACCCAGAGCGGCTCGCTCCACGTTTTCCTGACCAAGCTCCCCATCCTGGGCGATGCCTGCAGCACCAGGATTGCGTATCTCACCTCCCTCCT
CGAAGTCACTGTGGCC------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------------------GTGAAAAAGATTTTTCCTGACCCAAATGGGACCAGATTAGTCTTCATTGATGAAAAAA
GTGAGGGATTTGTCTACTGT--------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------------------------------AGGGATTTACAGCACTGGGACAGTGCTCTACAGCTGGCAAAGCGTTT
AGCCCCAGACCAGATACCGTTTATATCAAAAGAATATGCTATTCAGCTTGAATTC---GGTGATTATGTAAATGCATTGGCTCATTATGAGAAAGGAATA
ACAGGTGATAATAAGGAGCATGATGAGGTGTGTCTGGCCGGCATCGCCCAGATGTCCATAAGAATGGGAGACATCCGCCGAGGGGTTAGCCAGGCGCTCA
AACATCCCAGCAGGGTCCTTAAAAGAGACTGTGGTGCCATCCTGGAGAATATGAAGCAATTTTCAGAAGCAGCTCAGCTGTATGAAAAAGGTCTCTACTA
TGACAAAGCAGCATCTGTTTACATCCGCTGTAAGAAT---GCAAAAGTTGGTGAGCTTCTGCCTCACGTGTCTTCTCCAAAGATTCACTTGCAGTTTGCC
AAAGCTAAGGAAGCAGATGGA---TACAAAGAAGCCGTTGTGGCTTATGAGAATGCAAAGCAGTGGAACAGTGTAATTCGCATCTACCTGGATCACCTCA
ACAATCCCGAAAAGGCTGTCAGGATTGTCAGAGAGACCCAGTCCCTGGATGGAGCCAAAATGGTAGCC---TTTTTTCTCCAGCTAGGTGACTATGGGTC
TGCCATCCAGTTTCTTGTCATGTCCAAATGTAATAATGAAGCTTTCACACTGGCTCAGCAACACAACAAAATGGAAATCTATGTGGATGTTATT---TCT
GGAGACACTACTAATGAGGATTATCAAAGCATTGCCTTATATTTTGAAGGAGAAAAAAGACATTTTCAGGCTGGAAAATTCTTCTTGCTATGTGGCCAGT
ATGCACGAGCACTTAAACACTTCTTGAAATGTCCAAACTCAGAAGATAATGCTGCATTAGAAATGGCAATTGAAACTGTTGGTCAAGCCAAGGATGACGT
GCTGACCAGTCAGCTGATAGACCACCTTATGGGGGAGAGTGATGGCATGCCGAAGGATGCCAAGTACCTGTTCCGCTTGTACATGGCACTGAAGCAGTAC
CGAGAGGCCGCGCGCACCGCCATCATCATCGCCAGGGAAGAGCAGTCTGCA---AACTATCGGAACGCACATGACGTTCTCTTCAGCATGTACGCGGAAC
TGAAAGCCCAGAAGATCAAGATCCCCTCCGAGATGGCCACCAACCTCATGATTCTGCACAGTTACATCCTGGTGAAGATTCATGTTAAAAATGGAGATCA
TATGAAAGGGGCGCGTATGCTTATCCGGGTGGCCAAcaTCAGctTTCCGTCA---ATCGTGCCCATCCTGACGTCCACTGTCATCGAGTGTCACAGGGCT
GGCCTGAAGAACTCTGCCTTCAGCTTTGCAGCCACGTTGATGCGGCCCGAGTACCGCAACAAGATAGATGCCAAATACAAAAAGAAGATTGAGGCAATGG
TC---AGACCTGATACATCCGAGACAGAAGAGGCCACCACCCCGTGCCCATTCTGCGAATTTCTTCTCCCAGAGTGCGAACTCCTCTGTCCTGGATGTAA
AAATAACATCCCATATTGCATCGCAACAGGTCGACACATGCTGAAGGATGACTGGACGGTGTGTCCACACTGTGACTTCCCTGCTTTGTACTCAGAATTC
AAG---ATGTTAAACACTGAGAGAACATGTCCTATGTGTTCAGAAAGATTAAACTTGGCTCAACTGAAGAAAATCTCAGACTACACCCAGTACCTGCAGA
CAGAAGTGGAGCAGTGA


>BGISUSP0000883227
--RVFTLLEKTWLGTPIWFTWQKTSGNYLAVT-ADHIVKIFDRHGQQRSEINL--NCVAMDWDKDGDILAVIAEKSSYIYLWDANTNKTSQLDSGM----
------------------------------------KHTKRITCGCWNAENMLALGGEDKMITVSNQEGDTIRQTPVRSEPSDMQFSMMKTDDRTSAAES
-ISVVVGKKTLFLFNLSEPDNPIDLEFQQQYGNIVCYS-YGDGYIMIGFSRGIFVVISTHVREIGQEIFQARDHKDSLTSIAVSQTLNKATCGDN-IKIH
DLADLKDMYAIINLDDENK-LGTLSWTEDGQLLALSTQSGSLHVFLTKLPILGDACSTRIAYLTSLLEVTVA----------------------------
----------------------------------------------------------------------------------------------------
--------------VKKIFPDPNGTRLVFIDEKSEGFVYC------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------RDLQHWDSALQLAKRLAPDQIPFISKEYAIQLEF-GDYVNALAHYEKGI
TGDNKEHDEVCLAGIAQMSIRMGDIRRGVSQALKHPSRVLKRDCGAILENMKQFSEAAQLYEKGLYYDKAASVYIRCKN-AKVGELLPHVSSPKIHLQFA
KAKEADG-YKEAVVAYENAKQWNSVIRIYLDHLNNPEKAVRIVRETQSLDGAKMVA-FFLQLGDYGSAIQFLVMSKCNNEAFTLAQQHNKMEIYVDVI-S
GDTTNEDYQSIALYFEGEKRHFQAGKFFLLCGQYARALKHFLKCPNSEDNAALEMAIETVGQAKDDVLTSQLIDHLMGESDGMPKDAKYLFRLYMALKQY
REAARTAIIIAREEQSA-NYRNAHDVLFSMYAELKAQKIKIPSEMATNLMILHSYILVKIHVKNGDHMKGARMLIRVANISFPS-IVPILTSTVIECHRA
GLKNSAFSFAATLMRPEYRNKIDAKYKKKIEAMV-RPDTSETEEATTPCPFCEFLLPECELLCPGCKNNIPYCIATGRHMLKDDWTVCPHCDFPALYSEF
K-MLNTERTCPMCSERLNLAQLKKISDYTQYLQTEVEQ*