Sequences
EST Library Info
cov1Ovary - RNA from China
ecc1Foetus 50 days, cortex cerebri
eep2Foetus 50 days, epidermis
jca1Joint capsule
pigca1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000113758 (click for geneview)
Transcript ID ENST00000292385(link to ensembl)
Symbol NP_543157.1
Localtion Chromosome:5:176816220:176832805:-1 band: 5q35.3
Description drebrin 1 isoform b
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<------------------------------------------------------------------------------------------><-------
-M--A--G--H--P--W--H--G--T--A--A--L--A--S--S--Q--A--W--R--D--G--R--E--R--Q--A--L--V--S--C--R--A--L--
ATGGCTGGGCATCCATGGCATGGTACTGCAGCACTGGCCAGCAGCCAGGCCTGGAGGGATGGACGCGAGAGACAAGCTCTCGTGTCCTGCAGGGCTCTGT
                                                                                             :::::::
---------------------------------------------------------------------------------------------GCTCTGT
----------------------------------------------------------------------------------------------A--L--

-----------------------------------------------><---------------------------------------------------
Y--T--Y--E--D--G--S--D--D--L--K--L--A--A--S--G--E--G--G--L--Q--E--L--S--G--H--F--E--N--Q--K--V--M--Y
ACACATATGAAGATGGCTCCGATGACCTCAAGCTTGCAGCATCAGGAGAAGGGGGCTTGCAGGAGCTTTCGGGACACTTTGAGAACCAGAAGGTGATGTA
::::::::::.:::::::: :::::::::::::::::::::::::::   :::::::::::::::::.::::: :::::.::::::::::::::::::::
ACACATATGAGGATGGCTCAGATGACCTCAAGCTTGCAGCATCAGGA---GGGGGCTTGCAGGAGCTCTCGGGCCACTTCGAGAACCAGAAGGTGATGTA
Y--T--Y--E--D--G--S--D--D--L--K--L--A--A--S--G-----G--G--L--Q--E--L--S--G--H--F--E--N--Q--K--V--M--Y

------------------------------------------------------------><--------------------------------------
--G--F--C--S--V--K--D--S--Q--A--A--L--P--K--Y--V--L--I--N--W--V--G--E--D--V--P--D--A--R--K--C--A--C-
CGGCTTCTGCAGTGTCAAGGACTCCCAAGCTGCTCTGCCAAAATACGTGCTCATCAACTGGGTGGGCGAAGATGTGCCTGATGCCCGCAAGTGCGCTTGT
.:::::::::::.::::::::::::::.:::::::::::.:::::.::::::::::::::::: ::.:::::.:::::::::::::::::.:::::::::
TGGCTTCTGCAGCGTCAAGGACTCCCAGGCTGCTCTGCCGAAATATGTGCTCATCAACTGGGTTGGTGAAGACGTGCCTGATGCCCGCAAATGCGCTTGT
--G--F--C--S--V--K--D--S--Q--A--A--L--P--K--Y--V--L--I--N--W--V--G--E--D--V--P--D--A--R--K--C--A--C-

-----------------------------------><---------------------------------------------------------------
-A--S--H--V--A--K--V--A--E--F--F--Q--G--V--D--V--I--V--N--A--S--S--V--E--D--I--D--A--G--A--I--G--Q--
GCCAGCCACGTGGCTAAGGTGGCGGAGTTCTTCCAGGGTGTCGACGTGATCGTGAACGCCAGCAGCGTGGAAGACATAGACGCGGGTGCCATCGGGCAGC
:::::::::::::: :::::::: ::::::::::::::::: :::::::::::::::::::::::.::::::::::::::.:::::.:::::.:::::::
GCCAGCCACGTGGCGAAGGTGGCCGAGTTCTTCCAGGGTGTGGACGTGATCGTGAACGCCAGCAGTGTGGAAGACATAGATGCGGGCGCCATTGGGCAGC
-A--S--H--V--A--K--V--A--E--F--F--Q--G--V--D--V--I--V--N--A--S--S--V--E--D--I--D--A--G--A--I--G--Q--

----------------------------------------------------------------------------------><----------------
R--L--S--N--G--L--A--R--L--S--S--P--V--L--H--R--L--R--L--R--E--D--E--N--A--E--P--V--G--T--T--Y--Q--K
GGCTCTCTAACGGGCTGGCGCGACTCTCCAGCCCTGTGCTGCACCGACTGCGGCTGCGAGAGGATGAGAACGCAGAGCCCGTGGGCACCACCTACCAGAA
: :::::.::::::::::: ::.:::::::::::.::::: ::::::::::::::.:: :::::::::::.:: ::::: ::::::::::::::.:::::
GTCTCTCCAACGGGCTGGCTCGGCTCTCCAGCCCCGTGCTCCACCGACTGCGGCTACGCGAGGATGAGAATGCTGAGCCAGTGGGCACCACCTATCAGAA
R--L--S--N--G--L--A--R--L--S--S--P--V--L--H--R--L--R--L--R--E--D--E--N--A--E--P--V--G--T--T--Y--Q--K

------------------------------------------------------------><--------------------------------------
--T--D--A--A--V--E--M--K--R--I--N--R--E--Q--F--W--E--Q--A--K--K--E--E--E--L--R--K--E--E--E--R--K--K-
GACGGATGCAGCTGTGGAAATGAAGCGGATTAACCGAGAGCAGTTCTGGGAGCAGGCCAAGAAGGAAGAAGAGCTGCGGAAGGAGGAGGAGCGGAAGAAG
::::::.:::::::::::.:::::::::::::::::.:::::::::::::::::::::::::::::.::::::::: :::::::::::::::::::::::
GACGGACGCAGCTGTGGAGATGAAGCGGATTAACCGGGAGCAGTTCTGGGAGCAGGCCAAGAAGGAGGAAGAGCTGAGGAAGGAGGAGGAGCGGAAGAAG
--T--D--A--A--V--E--M--K--R--I--N--R--E--Q--F--W--E--Q--A--K--K--E--E--E--L--R--K--E--E--E--R--K--K-

----------------------------------------------------------------------------------------------------
-A--L--D--E--R--L--R--F--E--Q--E--R--M--E--Q--E--R--Q--E--Q--E--E--R--E--R--R--Y--R--E--R--E--Q--Q--
GCCCTGGATGAGAGGCTCAGGTTCGAGCAGGAGCGGATGGAGCAGGAGCGGCAGGAGCAAGAGGAGCGCGAGCGGCGCTACCGGGAGCGGGAGCAGCAGA
:::::::::::::::::::::::::::::.::::::::::::::.:::::::::::.::.:::::::: ::::::::.::::: ::::: ::::::::::
GCCCTGGATGAGAGGCTCAGGTTCGAGCAAGAGCGGATGGAGCAAGAGCGGCAGGAACAGGAGGAGCGGGAGCGGCGTTACCGTGAGCGTGAGCAGCAGA
-A--L--D--E--R--L--R--F--E--Q--E--R--M--E--Q--E--R--Q--E--Q--E--E--R--E--R--R--Y--R--E--R--E--Q--Q--

------------><--------------------------------------------------------------><----------------------
I--E--E--H--R--R--K--Q--Q--T--L--E--A--E--E--A--K--R--R--L--K--E--Q--S--I--F--G--D--H--R--D--E--E--E
TCGAGGAGCACAGGAGGAAACAGCAGACTTTAGAAGCGGAAGAGGCCAAGAGGCGGTTGAAGGAGCAGTCTATCTTTGGTGACCATCGGGATGAGGAGGA
:.::.::::::   :::::::::::::::::::::::.::.:::::::::::::::::: ::::::::::::::::::::::::: ::::::::::::::
TTGAAGAGCAC---AGGAAACAGCAGACTTTAGAAGCAGAGGAGGCCAAGAGGCGGTTGCAGGAGCAGTCTATCTTTGGTGACCAGCGGGATGAGGAGGA
I--E--E--H-----R--K--Q--Q--T--L--E--A--E--E--A--K--R--R--L--Q--E--Q--S--I--F--G--D--Q--R--D--E--E--E

------------------------------------><--------------------------------------------------------------
--E--T--H--M--K--K--S--E--S--E--V--E--E--A--A--A--I--I--A--Q--R--P--D--N--P--R--E--F--F--K--Q--Q--E-
AGAGACCCACATGAAGAAGTCAGAGTCGGAGGTGGAGGAGGCAGCAGCTATTATTGCCCAGCGGCCTGACAACCCAAGGGAGTTCTTCAAGCAGCAGGAA
::::::::: ::::::::::::::.::::::::.:::::::::::.::.::::::::::::::.:::::.:::::: :::::::::::::::::::::::
AGAGACCCAGATGAAGAAGTCAGAATCGGAGGTAGAGGAGGCAGCGGCCATTATTGCCCAGCGACCTGATAACCCACGGGAGTTCTTCAAGCAGCAGGAA
--E--T--Q--M--K--K--S--E--S--E--V--E--E--A--A--A--I--I--A--Q--R--P--D--N--P--R--E--F--F--K--Q--Q--E-

------------------------------------------------------------><--------------------------------------
-R--V--A--S--A--S--A--G--S--C--D--V--P--S--P--F--N--H--R--P--G--S--H--L--D--S--H--R--R--M--A--P--T--
AGAGTCGCATCGGCCTCTGCGGGCAGCTGTGATGTACCCTCGCCCTTCAACCATCGACCAGGCAGCCACCTGGACAGCCACCGGAGGATGGCGCCCACTC
::::::::::::::::::::.::::::::::::::.:::::.:::::::::::.::::::   ::::::::::::::.::::::::::::::::::::.:
AGAGTCGCATCGGCCTCTGCAGGCAGCTGTGATGTGCCCTCACCCTTCAACCACCGACCA---AGCCACCTGGACAGTCACCGGAGGATGGCGCCCACCC
-R--V--A--S--A--S--A--G--S--C--D--V--P--S--P--F--N--H--R--P-----S--H--L--D--S--H--R--R--M--A--P--T--

----------------------------------------------------------------------------------------------------
P--I--P--T--R--S--P--S--D--S--S--T--A--S--T--P--V--A--E--Q--I--E--R--A--L--D--E--V--T--S--S--Q--P--P
CCATCCCCACGCGGAGCCCGTCTGACTCCAGCACCGCCTCCACCCCTGTCGCTGAGCAGATAGAGCGGGCCCTGGATGAGGTCACCTCCTCGCAGCCTCC
::::.::.:: ::::::::.:::::::::::::: :::::.:::::::::::::::::::: ::::::::::::::::::::::: ::.:::::::::::
CCATTCCTACCCGGAGCCCATCTGACTCCAGCACGGCCTCTACCCCTGTCGCTGAGCAGATCGAGCGGGCCCTGGATGAGGTCACATCTTCGCAGCCTCC
P--I--P--T--R--S--P--S--D--S--S--T--A--S--T--P--V--A--E--Q--I--E--R--A--L--D--E--V--T--S--S--Q--P--P

-------------------------------><-------------------------------------------------------------------
--P--L--P--P--P--P--P--P--A--Q--E--T--Q--E--P--S--P--I--L--D--S--E--E--T--------------R--A--A--A--P-
ACCACTGCCACCGCCACCCCCACCAGCCCAAGAGACCCAGGAGCCCAGCCCCATCCTAGACAGTGAGGAGACC------------AGAGCAGCAGCCCCT
:::::::::::: ::::::::::::::::::   :::::::::::::::::.. :::.::.:::::.:::::             :::: ::::::::::
ACCACTGCCACCCCCACCCCCACCAGCCCAA---ACCCAGGAGCCCAGCCCTGGCCTGGATAGTGAAGAGACGAGCAAGGAAGCCAGAGAAGCAGCCCCT
--P--L--P--P--P--P--P--P--A--Q-----T--Q--E--P--S--P--G--L--D--S--E--E--T--S--K--E--A--R--E--A--A--P-

----------------------------------------------------------------------------------------------------
-Q--A--W--A--G--P--M--E--E--P--P--Q--A--Q--A--P--P--R--G--P--G--S--P--A--E--D--L--M--F--M--E--S--A--
CAGGCCTGGGCCGGCCCCATGGAGGAGCCCCCTCAGGCACAGGCGCCTCCCCGGGGGCCAGGCAGCCCTGCAGAGGACTTGATGTTCATGGAGTCTGCAG
:::::::::::.:::::..::::::::::::::::::::: :: ::::::::.::: : :::::::::. :.::::::::::::::::::: ::::.:::
CAGGCCTGGGCTGGCCCTGTGGAGGAGCCCCCTCAGGCACCGGAGCCTCCCCAGGGCCGAGGCAGCCCCCCGGAGGACTTGATGTTCATGGCGTCTACAG
-Q--A--W--A--G--P--V--E--E--P--P--Q--A--P--E--P--P--Q--G--R--G--S--P--P--E--D--L--M--F--M--A--S--T--

----------------------------------------------------------------------------------------------------
E--Q--A--V--L--A--A--P--V--E--P--A--T--A--D--A--T--E--I--H--D-----A--A--D--T--I--E--T--D--T--A--T--A
AGCAGGCTGTCCTGGCTGCTCCCGTGGAGCCTGCCACAGCTGACGCCACGGAGATCCACGAT---GCAGCTGACACCATTGAAACTGACACTGCCACTGC
:::::::::::::::::::.::. :.::::::::::..::::. ::: : : .... ::. .   :.::::::..::::::::.:.:::::::::.::::
AGCAGGCTGTCCTGGCTGCCCCTCTAGAGCCTGCCATGGCTGGAGCCTCTGCAGCTGACACCCTGGTAGCTGATGCCATTGAAGCCGACACTGCCGCTGC
E--Q--A--V--L--A--A--P--L--E--P--A--M--A--G--A--S--A--A--D--T--L--V--A--D--A--I--E--A--D--T--A--A--A

----------------------------------------------------------------------------------------------------
--D--T--T--V--A--N--N--V--P--P--A--A--T--S--L--I--D--L--W--P--G--N--G--E--G--A--S--T--L--Q--G--E--P-
TGACACCACTGTTGCCAACAACGTACCCCCCGCCGCCACCAGCCTCATTGACCTATGGCCTGGCAACGGGGAAGGGGCCTCCACACTCCAGGGTGAGCCC
:::::::.:::::::::::: .::  ::::.:: ::..::::::::::::::::::::::::::::.:::::.:.::::::..:::.::::: ::::::.
TGACACCGCTGTTGCCAACACTGTCACCCCTGCAGCTGCCAGCCTCATTGACCTATGGCCTGGCAATGGGGAGGAGGCCTCTGCACCCCAGGCTGAGCCT
--D--T--A--V--A--N--T--V--T--P--A--A--A--S--L--I--D--L--W--P--G--N--G--E--E--A--S--A--P--Q--A--E--P-

----------------------------------------------------------------------------------------------------
-R--A--P--T--P--P--S--G--T--E--V--T--L--A--E--V--P--L--L--D--E--V--A--P--E--P--L--L--P--A--G--E--G--
AGGGCCCCCACGCCACCCTCGGGTACTGAGGTCACCCTGGCAGAGGTGCCCCTGCTGGATGAGGTGGCTCCGGAGCCACTGCTGCCAGCAGGCGAAGGCT
:::::::::::.::::::::::::.:::::::: :.:::::::::::::::::::::::.:::::::::: :::::::::::..::::::::.:::::: 
AGGGCCCCCACACCACCCTCGGGTGCTGAGGTCCCTCTGGCAGAGGTGCCCCTGCTGGACGAGGTGGCTCAGGAGCCACTGCCACCAGCAGGTGAAGGCA
-R--A--P--T--P--P--S--G--A--E--V--P--L--A--E--V--P--L--L--D--E--V--A--Q--E--P--L--P--P--A--G--E--G--

----------------------------------------------------------------------------------------------------
C--A--T--L--L--N--F--D--E--L--P--E--P--P--A--T--F--C--D--P--E--E-----V--E--G--E--S--L--A--A--P--Q--T
GTGCCACCCTTCTCAACTTTGATGAGCTGCCTGAGCCGCCAGCCACCTTCTGTGACCCAGAGGAA---GTGGAAGGGGAGTCCCTGGCTGCCCCCCAGAC
::::.: .:::::.::.::::::::::: ::::::::::: ::.::::::::::::: ::::::.   ::.::::::: ::: :::::::.:::.:::.:
GTGCTAATCTTCTTAATTTTGATGAGCTTCCTGAGCCGCCCGCTACCTTCTGTGACCAAGAGGAGGAAGTAGAAGGGGTGTCGCTGGCTGTCCCTCAGGC
S--A--N--L--L--N--F--D--E--L--P--E--P--P--A--T--F--C--D--Q--E--E--E--V--E--G--V--S--L--A--V--P--Q--A

--------------------------------------------------------------------------------------------------->
--P--T--L--P--S--A--L--E--E--L--E--Q--E--Q--E--P--E--P--H--L--L--T--N--G--E--T--T--Q--K--E--G--T--Q-
CCCAACTCTGCCCTCAGCCCTTGAGGAGCTGGAGCAAGAGCAGGAGCCGGAGCCCCACCTGCTAACCAATGGCGAGACCACCCAGAAGGAGGGGACCCAG
.:::::::::::::::::.:: ::::::::::: : ::::: ::: : ::::                                                
TCCAACTCTGCCCTCAGCTCTAGAGGAGCTGGATCTAGAGCCGGATCGGGAG------------------------------------------------
--P--T--L--P--S--A--L--E--E--L--D--L--E--P--D--R--E-------------------------------------------------

<---------------------------------------------------------------------------------------------------
-A--S--E--G--Y--F--S--Q--S--Q--E--E--E--F--A--Q--S--E--E--L--C--A--K--A--P--P--P--V--F--Y--N--K--P--
GCCAGTGAGGGGTACTTCAGTCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTCTGTGCCAAGGCTCCGCCTCCTGTGTTCTACAACAAGCCTC
::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::: ::::: :::::.::::::::::::::::::::::::::::
GCCAGTGAGGGGTACTTCAGCCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTGTGTGCAAAGGCCCCGCCTCCTGTGTTCTACAACAAGCCTC
-A--S--E--G--Y--F--S--Q--S--Q--E--E--E--F--A--Q--S--E--E--L--C--A--K--A--P--P--P--V--F--Y--N--K--P--

--><--------------------------------------------------------------------->
P--E--I--D--I--T--C--W--D--A--D--P--V--P--E--E--E--E--G--F--E--G--G--D--*-
CAGAGATCGACATCACATGCTGGGATGCAGACCCAGTTCCAGAAGAGGAGGAGGGCTTCGAGGGTGGTGATTAG
::   ::::::::::: :::::::::::::::::::: :::::::::::::::::::::::::::::.::.:::
CA---ATCGACATCACTTGCTGGGATGCAGACCCAGTACCAGAAGAGGAGGAGGGCTTCGAGGGTGGCGACTAG
P-----I--D--I--T--C--W--D--A--D--P--V--P--E--E--E--E--G--F--E--G--G--D--*-

Pig Consensus Sequence

>BGISUST0000893150
---------------------------------------------------------------------------------------------GCTCTGT
ACACATATGAGGATGGCTCAGATGACCTCAAGCTTGCAGCATCAGGA---GGGGGCTTGCAGGAGCTCTCGGGCCACTTCGAGAACCAGAAGGTGATGTA
TGGCTTCTGCAGCGTCAAGGACTCCCAGGCTGCTCTGCCGAAATATGTGCTCATCAACTGGGTTGGTGAAGACGTGCCTGATGCCCGCAAATGCGCTTGT
GCCAGCCACGTGGCGAAGGTGGCCGAGTTCTTCCAGGGTGTGGACGTGATCGTGAACGCCAGCAGTGTGGAAGACATAGATGCGGGCGCCATTGGGCAGC
GTCTCTCCAACGGGCTGGCTCGGCTCTCCAGCCCCGTGCTCCACCGACTGCGGCTACGCGAGGATGAGAATGCTGAGCCAGTGGGCACCACCTATCAGAA
GACGGACGCAGCTGTGGAGATGAAGCGGATTAACCGGGAGCAGTTCTGGGAGCAGGCCAAGAAGGAGGAAGAGCTGAGGAAGGAGGAGGAGCGGAAGAAG
GCCCTGGATGAGAGGCTCAGGTTCGAGCAAGAGCGGATGGAGCAAGAGCGGCAGGAACAGGAGGAGCGGGAGCGGCGTTACCGTGAGCGTGAGCAGCAGA
TTGAAGAGCAC---AGGAAACAGCAGACTTTAGAAGCAGAGGAGGCCAAGAGGCGGTTGCAGGAGCAGTCTATCTTTGGTGACCAGCGGGATGAGGAGGA
AGAGACCCAGATGAAGAAGTCAGAATCGGAGGTAGAGGAGGCAGCGGCCATTATTGCCCAGCGACCTGATAACCCACGGGAGTTCTTCAAGCAGCAGGAA
AGAGTCGCATCGGCCTCTGCAGGCAGCTGTGATGTGCCCTCACCCTTCAACCACCGACCA---AGCCACCTGGACAGTCACCGGAGGATGGCGCCCACCC
CCATTCCTACCCGGAGCCCATCTGACTCCAGCACGGCCTCTACCCCTGTCGCTGAGCAGATCGAGCGGGCCCTGGATGAGGTCACATCTTCGCAGCCTCC
ACCACTGCCACCCCCACCCCCACCAGCCCAA---ACCCAGGAGCCCAGCCCTGGCCTGGATAGTGAAGAGACGAGCAAGGAAGCCAGAGAAGCAGCCCCT
CAGGCCTGGGCTGGCCCTGTGGAGGAGCCCCCTCAGGCACCGGAGCCTCCCCAGGGCCGAGGCAGCCCCCCGGAGGACTTGATGTTCATGGCGTCTACAG
AGCAGGCTGTCCTGGCTGCCCCTCTAGAGCCTGCCATGGCTGGAGCCTCTGCAGCTGACACCCTGGTAGCTGATGCCATTGAAGCCGACACTGCCGCTGC
TGACACCGCTGTTGCCAACACTGTCACCCCTGCAGCTGCCAGCCTCATTGACCTATGGCCTGGCAATGGGGAGGAGGCCTCTGCACCCCAGGCTGAGCCT
AGGGCCCCCACACCACCCTCGGGTGCTGAGGTCCCTCTGGCAGAGGTGCCCCTGCTGGACGAGGTGGCTCAGGAGCCACTGCCACCAGCAGGTGAAGGCA
GTGCTAATCTTCTTAATTTTGATGAGCTTCCTGAGCCGCCCGCTACCTTCTGTGACCAAGAGGAGGAAGTAGAAGGGGTGTCGCTGGCTGTCCCTCAGGC
TCCAACTCTGCCCTCAGCTCTAGAGGAGCTGGAT------------------------------------------------GCCAGTGAGGGGTACTTC
AGCCAATCACAGGAGGAGGAGTTTGCCCAATCGGAAGAGCTGTGTGCAAAGGCCCCGCCTCCTGTGTTCTACAACAAGCCTCCA---ATCGACATCACTT
GCTGGGATGCAGACCCAGTACCAGAAGAGGAGGAGGGCTTCGAGGGTGGCGACTAG


>BGISUSP0000893150
-------------------------------ALYTYEDGSDDLKLAASG-GGLQELSGHFENQKVMYGFCSVKDSQAALPKYVLINWVGEDVPDARKCAC
ASHVAKVAEFFQGVDVIVNASSVEDIDAGAIGQRLSNGLARLSSPVLHRLRLREDENAEPVGTTYQKTDAAVEMKRINREQFWEQAKKEEELRKEEERKK
ALDERLRFEQERMEQERQEQEERERRYREREQQIEEH-RKQQTLEAEEAKRRLQEQSIFGDQRDEEEETQMKKSESEVEEAAAIIAQRPDNPREFFKQQE
RVASASAGSCDVPSPFNHRP-SHLDSHRRMAPTPIPTRSPSDSSTASTPVAEQIERALDEVTSSQPPPLPPPPPPAQ-TQEPSPGLDSEETSKEAREAAP
QAWAGPVEEPPQAPEPPQGRGSPPEDLMFMASTEQAVLAAPLEPAMAGASAADTLVADAIEADTAAADTAVANTVTPAAASLIDLWPGNGEEASAPQAEP
RAPTPPSGAEVPLAEVPLLDEVAQEPLPPAGEGSANLLNFDELPEPPATFCDQEEEVEGVSLAVPQAPTLPSALEELD----------------ASEGYF
SQSQEEEFAQSEELCAKAPPPVFYNKPP-IDITCWDADPVPEEEEGFEGGD*