Sequences
EST Library Info
cov3Ovary - RNA from China
csp1Spleen - RNA from China
ebs4Foetus 50 days, brain stem
fat1Fatt
fcc2Unavailable
hyp1Hypothalamus
pigcb5Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000096467 (click for geneview)
Transcript ID ENST00000293664(link to ensembl)
Symbol BAT5
Localtion Chromosome:6:31762715:31779071:-1 band: 6p21.33
Description Protein BAT5 (HLA-B-associated transcript 5) (NG26 protein) (G5 protein). [Source:Uniprot/SWISSPROT;Acc:O95870]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--K--L--L--S--C--V--L--G--P--R--L--Y--K--I--Y--R--E--R--D--S--E--R--A--P--A--S--V--P--E--T--P--
ATGGCGAAGCTGCTGAGCTGCGTCCTAGGCCCCCGGCTCTACAAAATCTACCGGGAGAGGGACTCTGAAAGGGCCCCGGCCAGCGTCCCTGAGACGCCAA
::::::::::::::::::::::::::::: ::::::::::::::::::::::::::.:::::::: ::::::::: :: :..:.:::::::.::: ::::
ATGGCGAAGCTGCTGAGCTGCGTCCTAGGACCCCGGCTCTACAAAATCTACCGGGAAAGGGACTCAGAAAGGGCCGCGTCTGGTGTCCCTGGGACTCCAA
-M--A--K--L--L--S--C--V--L--G--P--R--L--Y--K--I--Y--R--E--R--D--S--E--R--A--A--S--G--V--P--G--T--P--

-------------------------------><-------------------------------------------------------><----------
T--A--V--T--A--P--H--S--S--S--W--D--T--Y--Y--Q--P--R--A--L--E--K--H--A--D--S--I--L--A--L--A--S--V--F
CGGCAGTCACTGCCCCCCATTCCAGCTCCTGGGATACGTACTATCAGCCCCGTGCCCTGGAGAAACATGCTGACAGCATCCTGGCACTGGCTTCAGTATT
:  ::::::::.:: ::. ::::::::::::::::::.::.::::::::::::::::: ::::::::::::::::::::::: ::.::::::::::: ::
CTTCAGTCACTACCGCCTCTTCCAGCTCCTGGGATACATATTATCAGCCCCGTGCCCTCGAGAAACATGCTGACAGCATCCTCGCGCTGGCTTCAGTCTT
T--S--V--T--T--A--S--S--S--S--W--D--T--Y--Y--Q--P--R--A--L--E--K--H--A--D--S--I--L--A--L--A--S--V--F

-------------------------------------------------------><-------------------------------------------
--W--S--I--S--Y--Y--S--S--P--F--A--F--F--Y--L--Y--R--K--G--Y--L--S--L--S--K--V--V--P--F--S--H--Y--A-
CTGGTCCATCTCTTATTACTCCTCTCCCTTCGCCTTCTTCTACTTGTACAGGAAAGGTTACTTGAGTTTGTCCAAAGTGGTGCCGTTTTCTCACTATGCT
:::::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::::::::.
CTGGTCCATCTCTTATTACTCCTCTCCCTTCGCCTTCTTCTACTTGTACAGGAAA---TACTTGAGTTTGTCCAAAGTGGTGCCGTTTTCTCACTATGCC
--W--S--I--S--Y--Y--S--S--P--F--A--F--F--Y--L--Y--R--K-----Y--L--S--L--S--K--V--V--P--F--S--H--Y--A-

------------------------------------------><--------------------------------------------------------
-G--T--L--L--L--L--L--A--G--V--A--C--L--R--G--I--G--R--W--T--N--P--Q--Y--R--Q--F--I--T--I--L--E--A--
GGGACATTGCTGCTACTTCTGGCAGGTGTGGCCTGCCTCCGAGGCATTGGCCGCTGGACCAACCCCCAGTACCGGCAGTTCATCACCATCTTGGAAGCAA
::::::::::: ::::: :::::.:: :::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::.:::.
GGGACATTGCTTCTACTGCTGGCGGGAGTGGCCTGCCTCCGA---ATTGGCCGCTGGACCAACCCCCAGTACCGGCAGTTCATCACCATCTTGGAGGCAG
-G--T--L--L--L--L--L--A--G--V--A--C--L--R-----I--G--R--W--T--N--P--Q--Y--R--Q--F--I--T--I--L--E--A--

----------------------------><----------------------------------------------------------------------
T--H--R--N--Q--S--S--E--N--K--R--Q--L--A--N--Y--N--F--D--F--R--S--W--P--V--D--F--H--W--E--E--P--S--S
CACATCGGAACCAGTCTTCAGAAAACAAGAGGCAGCTTGCCAACTACAACTTTGACTTCCGGAGCTGGCCAGTCGACTTCCACTGGGAAGAACCCAGCAG
::::: ::::::::::. ::::.::::::                                                                       
CACATAGGAACCAGTCCGCAGAGAACAAG-----------------------------------------------------------------------
A--H--R--N--Q--S--A--E--N--K------------------------------------------------------------------------

--><------------------------------------------------------------------------------------------------
--R--K--E--S--R--G--G--P-----S--R--R--G--V--A-----L--L--R--P--E--P--L--H--R--G--T--A--D--T--L--L--N-
CCGGAAGGAGTCTCGAGGGGGCCCT---TCCCGCCGGGGTGTGGCC---CTGCTTCGCCCAGAGCCCCTGCACCGGGGGACAGCAGACACCCTCCTCAAC
                ::::: ::.    ::::::::::.::.: :      . .::::::::::::::::::::::::::.::::::::::::::::::
----------------GGGGGGCCCTATACCCGCCGGGGCGTAGGCCCTAGCTACCGCCCAGAGCCCCTGCACCGGGGGACGGCAGACACCCTCCTCAAC
-----------------G--G--P--Y--T--R--R--G--V--G--P--S--Y--R--P--E--P--L--H--R--G--T--A--D--T--L--L--N-

-------------------------------><-------------------------------------------------------------------
-R--V--K--K--L--P--C--Q--I--T--S--Y--L--V--A--H--T--L--G--R--R--M--L--Y--P--G--S--V--Y--L--L--Q--K--
CGGGTTAAGAAGCTGCCTTGTCAGATCACCAGCTACCTGGTGGCGCACACCCTAGGGCGCCGGATGCTGTATCCAGGCTCTGTGTACCTGCTGCAGAAGG
:::::.::::::::::::::::::::::::            ::.::::::::.:: :::::::::::::::::.:::::.::::::::::: :::::::
CGGGTCAAGAAGCTGCCTTGTCAGATCACC------------GCACACACCCTGGGCCGCCGGATGCTGTATCCGGGCTCCGTGTACCTGCTCCAGAAGG
-R--V--K--K--L--P--C--Q--I--T--------------A--H--T--L--G--R--R--M--L--Y--P--G--S--V--Y--L--L--Q--K--

----------------------------------------------><----------------------------------------------------
A--L--M--P--V--L--L--Q--G--Q--A--R--L--V--E--E--C--N--G--R--R--A--K--L--L--A--C--D--G--N--E--I--D--T
CCCTCATGCCTGTGCTGCTGCAGGGCCAGGCCCGACTGGTGGAAGAGTGTAATGGGCGCCGGGCAAAGCTGCTGGCCTGTGATGGCAATGAGATTGACAC
::::::::::::::::::::::::::::::::::.::::::::::::::::::::.::::::::::::::::::::::::::.:::::.:::::::::::
CCCTCATGCCTGTGCTGCTGCAGGGCCAGGCCCGGCTGGTGGAAGAGTGTAATGGACGCCGGGCAAAGCTGCTGGCCTGTGACGGCAACGAGATTGACAC
A--L--M--P--V--L--L--Q--G--Q--A--R--L--V--E--E--C--N--G--R--R--A--K--L--L--A--C--D--G--N--E--I--D--T

------------------------------------------------><--------------------------------------------------
--M--F--V--D--R--R--G--T--A--E--P--Q--G--Q--K--L--V--I--C--C--E--G--N--A--G--F--Y--E--V--G--C--V--S-
CATGTTTGTGGACCGGCGGGGGACAGCTGAGCCCCAGGGACAGAAGCTGGTGATCTGCTGTGAGGGGAATGCTGGGTTTTATGAGGTGGGCTGCGTCTCC
:::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::.:: :: ::.:::::::::::::::::::::
CATGTTTGTGGACCGGCGGGGGACAGCCGAGCCCCAGGGACAGAAGCTGGTGATCTGCTGTGAGGGGAACGCAGGCTTCTATGAGGTGGGCTGCGTCTCC
--M--F--V--D--R--R--G--T--A--E--P--Q--G--Q--K--L--V--I--C--C--E--G--N--A--G--F--Y--E--V--G--C--V--S-

------------><------------------------------------------------><------------------------------------
-T--P--L--E--A--G--Y--S--V--L--G--W--N--H--P--G--F--A--G--S--T--G--V--P--F--P--Q--N--E--A--N--A--M--
ACGCCCCTGGAAGCTGGATATTCAGTCCTGGGCTGGAATCATCCAGGCTTTGCTGGAAGCACGGGGGTGCCATTCCCGCAGAATGAGGCTAATGCCATGG
:: :::::::::   :::::::::::::::::::::::.::::: ::::::::::::::::::::::::::.:::::.:::::.:::::.::::::::::
ACCCCCCTGGAA---GGATATTCAGTCCTGGGCTGGAACCATCCCGGCTTTGCTGGAAGCACGGGGGTGCCGTTCCCACAGAACGAGGCCAATGCCATGG
-T--P--L--E-----G--Y--S--V--L--G--W--N--H--P--G--F--A--G--S--T--G--V--P--F--P--Q--N--E--A--N--A--M--

--------------------------------------------------------------------------------------><------------
D--V--V--V--Q--F--A--I--H--R--L--G--F--Q--P--Q--D--I--I--I--Y--A--W--S--I--G--G--F--T--A--T--W--A--A
ATGTGGTGGTCCAGTTTGCCATCCACCGCCTAGGCTTCCAGCCCCAGGACATCATCATCTACGCCTGGTCCATCGGCGGCTTCACTGCCACGTGGGCAGC
:::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.::::::::::::::::::::::::   ::.::::::::
ATGTGGTGGTCCAGTTTGCCATCCACCGCCTGGGCTTCCAGCCCCAGGACATCATCATCTATGCCTGGTCCATCGGCGGCTTCACT---ACATGGGCAGC
D--V--V--V--Q--F--A--I--H--R--L--G--F--Q--P--Q--D--I--I--I--Y--A--W--S--I--G--G--F--T-----T--W--A--A

-------------------------------------------------------------------------------------------><-------
--M--S--Y--P--D--V--S--A--M--I--L--D--A--S--F--D--D--L--V--P--L--A--L--K--V--M--P--D--S--W--R--G--L-
CATGTCCTACCCAGATGTTAGTGCCATGATCCTGGATGCCTCCTTTGATGACCTGGTGCCCTTGGCCTTGAAGGTCATGCCAGACAGCTGGAGGGGCCTG
:::::::::::::::..::::.:::.:::::::::::::::::::.:::::::::::::::::::::::::::::.:::::::::::::::   ::::::
CATGTCCTACCCAGACATTAGCGCCGTGATCCTGGATGCCTCCTTCGATGACCTGGTGCCCTTGGCCTTGAAGGTTATGCCAGACAGCTGG---GGCCTG
--M--S--Y--P--D--I--S--A--V--I--L--D--A--S--F--D--D--L--V--P--L--A--L--K--V--M--P--D--S--W-----G--L-

-------------------------------------------------------><-------------------------------------------
-V--T--R--T--V--R--Q--H--L--N--L--N--N--A--E--Q--L--C--R--Y--Q--G--P--V--L--L--I--R--R--T--K--D--E--
GTGACCAGGACCGTGAGGCAGCATCTCAATCTAAACAACGCGGAGCAGCTGTGCAGATACCAGGGTCCTGTACTGCTGATCCGGAGAACCAAGGATGAGA
:::::::::::.::::::::::::::::::::::::::::::::.:::::::::   ::::::::.:::::.:::::::::::.::::::::::::::::
GTGACCAGGACTGTGAGGCAGCATCTCAATCTAAACAACGCGGAACAGCTGTGC---TACCAGGGCCCTGTGCTGCTGATCCGAAGAACCAAGGATGAGA
-V--T--R--T--V--R--Q--H--L--N--L--N--N--A--E--Q--L--C-----Y--Q--G--P--V--L--L--I--R--R--T--K--D--E--

------------><-------------------------------------------------------------><-----------------------
I--I--T--T--T--V--P--E--D--I--M--S--N--R--G--N--D--L--L--L--K--L--L--Q--H--R--Y--P--R--V--M--A--E--E
TCATCACCACCACGGTTCCTGAGGACATCATGTCCAACCGAGGCAATGACCTCCTGCTGAAGCTCCTGCAGCATCGGTATCCCCGGGTGATGGCAGAGGA
:::::::::::   :::::::::::..::::::: ::.:::::::::::::::::::::::::: :::::::::   :::::::: ::::::::::::::
TCATCACCACC---GTTCCTGAGGATGTCATGTCGAATCGAGGCAATGACCTCCTGCTGAAGCTGCTGCAGCAT---TATCCCCGTGTGATGGCAGAGGA
I--I--T--T-----V--P--E--D--V--M--S--N--R--G--N--D--L--L--L--K--L--L--Q--H-----Y--P--R--V--M--A--E--E

----------------------------------------------------><----------------------------------------------
--G--L--R--V--V--R--Q--W--L--E--A--S--S--Q--L--E--E--A--S--I--Y--S--R--W--E--V--E--E--D--W--C--L--S-
GGGTCTTCGAGTGGTGAGGCAGTGGTTGGAGGCCTCCTCACAGCTGGAGGAAGCCTCAATTTATAGCCGATGGGAGGTGGAAGAGGACTGGTGTCTGTCT
::: :::::::::::::::::::::.:::::::::::::::::::.::::::   ::::::::.:::::::::::.:::::.:::::::::::.::::: 
GGGGCTTCGAGTGGTGAGGCAGTGGCTGGAGGCCTCCTCACAGCTAGAGGAA---TCAATTTACAGCCGATGGGAAGTGGAGGAGGACTGGTGCCTGTCG
--G--L--R--V--V--R--Q--W--L--E--A--S--S--Q--L--E--E-----S--I--Y--S--R--W--E--V--E--E--D--W--C--L--S-

---------------------------------------------------><---------------------------------------------><
-V--L--R--S--Y--Q--A--E--H--G--P--D--F--P--W--S--V--G--E--D--M--S--A--D--G--R--R--Q--L--A--L--F--L--
GTCCTCCGCTCCTACCAGGCAGAACACGGGCCCGACTTCCCCTGGAGCGTGGGGGAGGACATGAGTGCAGATGGACGGCGGCAGCTGGCTTTGTTTCTGG
:::::::::::::::::::: ::.::::::::::: :::::::::::::::   ::::::::::::::::::::  :.:::::::::::.::::::::::
GTCCTCCGCTCCTACCAGGCCGAGCACGGGCCCGAGTTCCCCTGGAGCGTG---GAGGACATGAGTGCAGATGGCAGACGGCAGCTGGCCTTGTTTCTGG
-V--L--R--S--Y--Q--A--E--H--G--P--E--F--P--W--S--V-----E--D--M--S--A--D--G--R--R--Q--L--A--L--F--L--

---------------------------------------------------------------------------------->
A--R--K--H--L--H--N--F--E--A--T--H--C--T--P--L--P--A--Q--N--F--Q--M--P--W--H--L--*-
CTCGGAAGCATCTGCACAACTTTGAGGCCACTCACTGCACCCCACTCCCAGCCCAGAACTTCCAGATGCCCTGGCACCTCTAG
:::.::::::::::::::::::::::::::: :::::::::::.:::::.:::                              
CTCAGAAGCATCTGCACAACTTTGAGGCCACACACTGCACCCCGCTCCCGGCC------------------------------
A--Q--K--H--L--H--N--F--E--A--T--H--C--T--P--L--P--A-------------------------------

Pig Consensus Sequence

>BGISUST0000888520
ATGGCGAAGCTGCTGAGCTGCGTCCTAGGACCCCGGCTCTACAAAATCTACCGGGAAAGGGACTCAGAAAGGGCCGCGTCTGGTGTCCCTGGGACTCCAA
CTTCAGTCACTACCGCCTCTTCCAGCTCCTGGGATACATATTATCAGCCCCGTGCCCTCGAGAAACATGCTGACAGCATCCTCGCGCTGGCTTCAGTCTT
CTGGTCCATCTCTTATTACTCCTCTCCCTTCGCCTTCTTCTACTTGTACAGGAAA---TACTTGAGTTTGTCCAAAGTGGTGCCGTTTTCTCACTATGCC
GGGACATTGCTTCTACTGCTGGCGGGAGTGGCCTGCCTCCGA---ATTGGCCGCTGGACCAACCCCCAGTACCGGCAGTTCATCACCATCTTGGAGGCAG
CACATAGGAACCAGTCCGCAGAGAACAAG-----------------------------------------------------------------------
----------------GGGGGGCCCTATACCCGCCGGGGCGTAGGCCCTAGCTACCGCCCAGAGCCCCTGCACCGGGGGACGGCAGACACCCTCCTCAAC
CGGGTCAAGAAGCTGCCTTGTCAG------------GCACACACCCTGGGCCGCCGGATGCTGTATCCGGGCTCCGTGTACCTGCTCCAGAAGGCCCTCA
TGCCTGTGCTGCTGCAGGGCCAGGCCCGGCTGGTGGAAGAGTGTAATGGACGCCGGGCAAAGCTGCTGGCCTGTGACGGCAACGAGATTGACACCATGTT
TGTGGACCGGCGGGGGACAGCCGAGCCCCAGGGACAGAAGCTGGTGATCTGCTGTGAGGGGAACGCAGGCTTCTATGAGGTGGGCTGCGTCTCCACCCCC
CTGGAA---GGATATTCAGTCCTGGGCTGGAACCATCCCGGCTTTGCTGGAAGCACGGGGGTGCCGTTCCCACAGAACGAGGCCAATGCCATGGATGTGG
TGGTCCAGTTTGCCATCCACCGCCTGGGCTTCCAGCCCCAGGACATCATCATCTATGCCTGGTCCATCGGCGGCTTCACT---ACATGGGCAGCCATGTC
CTACCCAGACATTAGCGCCGTGATCCTGGATGCCTCCTTCGATGACCTGGTGCCCTTGGCCTTGAAGGTTATGCCAGACAGCTGG---GGCCTGGTGACC
AGGACTGTGAGGCAGCATCTCAATCTAAACAACGCGGAACAGCTGTGC---TACCAGGGCCCTGTGCTGCTGATCCGAAGAACCAAGGATGAGATCATCA
CCACC---GTTCCTGAGGATGTCATGTCGAATCGAGGCAATGACCTCCTGCTGAAGCTGCTGCAGCAT---TATCCCCGTGTGATGGCAGAGGAGGGGCT
TCGAGTGGTGAGGCAGTGGCTGGAGGCCTCCTCACAGCTAGAGGAA---TCAATTTACAGCCGATGGGAAGTGGAGGAGGACTGGTGCCTGTCGGTCCTC
CGCTCCTACCAGGCCGAGCACGGGCCCGAGTTCCCCTGGAGCGTG---GAGGACATGAGTGCAGATGGCAGACGGCAGCTGGCCTTGTTTCTGGCTCAGA
AGCATCTGCACAACTTTGAGGCCACACACTGCACCCCGCTCCCGGCC------------------------------


>BGISUSP0000888520
MAKLLSCVLGPRLYKIYRERDSERAASGVPGTPTSVTTASSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK-YLSLSKVVPFSHYA
GTLLLLLAGVACLR-IGRWTNPQYRQFITILEAAHRNQSAENK-----------------------------GGPYTRRGVGPSYRPEPLHRGTADTLLN
RVKKLPCQ----AHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTP
LE-GYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIIIYAWSIGGFT-TWAAMSYPDISAVILDASFDDLVPLALKVMPDSW-GLVT
RTVRQHLNLNNAEQLC-YQGPVLLIRRTKDEIITT-VPEDVMSNRGNDLLLKLLQH-YPRVMAEEGLRVVRQWLEASSQLEE-SIYSRWEVEEDWCLSVL
RSYQAEHGPEFPWSV-EDMSADGRRQLALFLAQKHLHNFEATHCTPLPA----------