Sequences
EST Library Info
pan2Pancreas
Clusters
Oligos
SNPs

Gene ID ENSG00000162438 (click for geneview)
Transcript ID ENST00000294427(link to ensembl)
Symbol CTRC
Localtion Chromosome:1:15510241:15518451:1 band: 1p36.21
Description Caldecrin precursor (EC 3.4.21.2) (Chymotrypsin C). [Source:Uniprot/SWISSPROT;Acc:Q99895]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------><-----------------------------------------------------------
-M--L--G--I--T--V--L--A--A--L--L--A--C--A--S--S--C--G--V--P--S--F--P--P--N--L--S--A--R--V--V--G--G--
ATGTTGGGCATCACTGTCCTCGCTGCGCTCTTGGCCTGTGCCTCCAGCTGTGGGGTGCCCAGCTTCCCGCCCAACCTATCCGCCCGAGTGGTGGGAGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------><-------------------------------------------------------------------
E--D--A--R--P--H--S--W--P--W--Q--I--S--L--Q--Y--L--K--N--D--T--W--R--H--T--C--G--G--T--L--I--A--S--N
AGGATGCCCGGCCCCACAGCTGGCCCTGGCAGATCTCCCTCCAGTACCTCAAGAACGACACGTGGAGGCATACGTGTGGCGGGACTTTGATTGCTAGCAA
                                   ::.:::::::::::::::.:::::::.::::::::.:: ::::: ::.: :.: ::..:.: ::.
-----------------------------------TCTCTCCAGTACCTCAAGGACGACACATGGAGGCACACCTGTGGGGGAAGTCTCATCACCACCAG
------------------------------------S--L--Q--Y--L--K--D--D--T--W--R--H--T--C--G--G--S--L--I--T--T--S

-----------------------------><---------------------------------------------------------------------
--F--V--L--T--A--A--H--C--I--S--N--T--R--T--Y--R--V--A--V--G--K--N--N--L--E--V--E--D--E--E--G--S--L-
CTTCGTCCTCACTGCCGCCCACTGCATCAGCAACACCCGGACCTACCGTGTGGCCGTGGGAAAGAACAACCTGGAGGTGGAAGACGAAGAAGGATCCCTG
:. :::::::::::::::::::::::::   ::: :::::::.:::::.:::::: ::::.::::::::::::::::::::::::::.::::: :::.::
CCACGTCCTCACTGCCGCCCACTGCATC---AACTCCCGGACTTACCGCGTGGCCCTGGGGAAGAACAACCTGGAGGTGGAAGACGAGGAAGGCTCCTTG
--H--V--L--T--A--A--H--C--I-----N--S--R--T--Y--R--V--A--L--G--K--N--N--L--E--V--E--D--E--E--G--S--L-

-------------------------------------------------------><-------------------------------------------
-F--V--G--V--D--T--I--H--V--H--K--R--W--N--A--L--L--L--R--N--D--I--A--L--I--K--L--A--E--H--V--E--L--
TTTGTGGGTGTGGACACCATCCACGTCCACAAGAGATGGAATGCCCTCCTGTTGCGCAATGATATTGCCCTCATCAAGCTTGCAGAGCATGTGGAGCTGA
 :.:::::::::::.: ::::. .:::::..:::..:::::. ::.: :::      :::::.::::::::.:::::::: :: :::: .:::::.::::
GTCGTGGGTGTGGATAGCATCTTTGTCCATGAGAAGTGGAACTCCTTGCTG------AATGACATTGCCCTTATCAAGCTGGCTGAGCCCGTGGAACTGA
-V--V--G--V--D--S--I--F--V--H--E--K--W--N--S--L--L--------N--D--I--A--L--I--K--L--A--E--P--V--E--L--

--------------------------------------------------------------------------------------------><------
S--D--T--I--Q--V--A--C--L--P--E--K--D--S--L--L--P--K--D--Y--P--C--Y--V--T--G--W--G--R--L--W--T--N--G
GTGACACCATCCAGGTGGCCTGCCTGCCAGAGAAGGACTCCCTGCTCCCCAAGGACTACCCCTGCTATGTCACCGGCTGGGGCCGCCTCTGGACCAACGG
:::::::.::::::::: : ::::::::.:::.:::.::::.:::: ::. ::::::::::::::::::::::.::::::::::::::::::   ::.::
GTGACACTATCCAGGTGTCATGCCTGCCGGAGGAGGGCTCCTTGCTGCCTCAGGACTACCCCTGCTATGTCACTGGCTGGGGCCGCCTCTGG---AATGG
S--D--T--I--Q--V--S--C--L--P--E--E--G--S--L--L--P--Q--D--Y--P--C--Y--V--T--G--W--G--R--L--W-----N--G

----------------------------------------------------------------------------------------------------
--P--I--A--D--K--L--Q--Q--G--L--Q--P--V--V--D--H--A--T--C--S--R--I--D--W--W--G--F--R--V--K--K--T--M-
CCCCATTGCTGATAAGCTGCAGCAGGGCCTGCAGCCCGTGGTGGATCACGCCACGTGCTCCAGGATTGACTGGTGGGGCTTCAGGGTGAAGAAAACCATG
.:::::.::::: . ::: ::::::::::::::::::.: :::...::.::::::::::::::: : :::::::::  : :::.:::  .:::.:: :::
TCCCATCGCTGAAGTGCTCCAGCAGGGCCTGCAGCCCATCGTGAGCCATGCCACGTGCTCCAGGTTGGACTGGTGGTTCATCAAGGTCCGGAAGACGATG
--P--I--A--E--V--L--Q--Q--G--L--Q--P--I--V--S--H--A--T--C--S--R--L--D--W--W--F--I--K--V--R--K--T--M-

--------------------------------------><------------------------------------------------------------
-V--C--A--G--G--D--G--V--I--S--A--C--N--G--D--S--G--G--P--L--N--C--Q--L--E--N--G--S--W--E--V--F--G--
GTGTGCGCTGGGGGCGATGGCGTCATCTCAGCCTGCAATGGGGACTCCGGTGGCCCACTGAACTGCCAGTTGGAGAACGGTTCCTGGGAGGTGTTTGGCA
::::::::::::::.:::::::::::::: :::::.   :::::::: ::.:::::::::::::::::: . ::::::::.::::::::::::.  ::::
GTGTGCGCTGGGGGTGATGGCGTCATCTCTGCCTGT---GGGGACTCGGGCGGCCCACTGAACTGCCAGGCCGAGAACGGCTCCTGGGAGGTGCGGGGCA
-V--C--A--G--G--D--G--V--I--S--A--C-----G--D--S--G--G--P--L--N--C--Q--A--E--N--G--S--W--E--V--R--G--

-------------------------------------------------------------------------------------------><-------
I--V--S--F--G--S--R--R--G--C--N--T--R--K--K--P--V--V--Y--T--R--V--S--A--Y--I--D--W--I--N--E--K--M--Q
TCGTCAGCTTTGGCTCCCGGCGGGGCTGCAACACCCGCAAGAAGCCGGTAGTCTACACCCGGGTGTCCGCCTACATCGACTGGATCAACGAGAAAATGCA
::::::::::.:::::: ::. :::::::::::::..::::::::: ..::::: :::::: ::::::::::::::::::::::::.:: ::        
TCGTCAGCTTCGGCTCCGGGTTGGGCTGCAACACCTACAAGAAGCCCACAGTCTTCACCCGCGTGTCCGCCTACATCGACTGGATCGACCAG--------
I--V--S--F--G--S--G--L--G--C--N--T--Y--K--K--P--T--V--F--T--R--V--S--A--Y--I--D--W--I--D--Q---------

------>
--L--*-
GCTGTGA
       
-------
-------

Pig Consensus Sequence

>BGISUST0000898260
----------------------------------------------------------------------------------------------------
-----------------------------------TCTCTCCAGTACCTCAAGGACGACACATGGAGGCACACCTGTGGGGGAAGTCTCATCACCACCAG
CCACGTCCTCACTGCCGCCCACTGCATC---AACTCCCGGACTTACCGCGTGGCCCTGGGGAAGAACAACCTGGAGGTGGAAGACGAGGAAGGCTCCTTG
GTCGTGGGTGTGGATAGCATCTTTGTCCATGAGAAGTGGAACTCCTTGCTG------AATGACATTGCCCTTATCAAGCTGGCTGAGCCCGTGGAACTGA
GTGACACTATCCAGGTGTCATGCCTGCCGGAGGAGGGCTCCTTGCTGCCTCAGGACTACCCCTGCTATGTCACTGGCTGGGGCCGCCTCTGG---AATGG
TCCCATCGCTGAAGTGCTCCAGCAGGGCCTGCAGCCCATCGTGAGCCATGCCACGTGCTCCAGGTTGGACTGGTGGTTCATCAAGGTCCGGAAGACGATG
GTGTGCGCTGGGGGTGATGGCGTCATCTCTGCCTGT---GGGGACTCGGGCGGCCCACTGAACTGCCAGGCCGAGAACGGCTCCTGGGAGGTGCGGGGCA
TCGTCAGCTTCGGCTCCGGGTTGGGCTGCAACACCTACAAGAAGCCCACAGTCTTCACCCGCGTGTCCGCCTACATCGACTGGATCGACCAG--------
-------


>BGISUSP0000898260
---------------------------------------------SLQYLKDDTWRHTCGGSLITTSHVLTAAHCI-NSRTYRVALGKNNLEVEDEEGSL
VVGVDSIFVHEKWNSLL--NDIALIKLAEPVELSDTIQVSCLPEEGSLLPQDYPCYVTGWGRLW-NGPIAEVLQQGLQPIVSHATCSRLDWWFIKVRKTM
VCAGGDGVISAC-GDSGGPLNCQAENGSWEVRGIVSFGSGLGCNTYKKPTVFTRVSAYIDWIDQ-----