Sequences
EST Library Info
dbla1Unavailable
gul1Gullet
mga1Mammary gland - 7 days after weaning
mgp1Mammary gland - 7 days pre birth
pan1Pancreas
pgl1Pituitary gland
pigcb1Unavailable
pliv1Unavailable
rec2Rectum
sag1Salivary gland
ski1Skin
Clusters
Oligos
SNPs

Gene ID ENSG00000162647 (click for geneview)
Transcript ID ENST00000294665(link to ensembl)
Localtion Chromosome:1:109345416:109351594:1 band: 1p13.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--L--S--L--V--F--R--A--A--S--Y--F--K--L--V--P--F--H--S--S--S-----S--N--Q--F--L--Q--P--P--G--W--
ATGTCTCTAAGCTTGGTGTTTAGAGCTGCTTCATATTTTAAACTAGTTCCATTCCACAGTTCTAGT---TCAAACCAGTTTTTACAGCCTCCTGGGTGGG
   :::::::::::::::.:::::::.::::::::::::::::::::::::::.:::::.::::::   ::::::::::::::::::::::::::.::::
---TCTCTAAGCTTGGTGCTTAGAGCCGCTTCATATTTTAAACTAGTTCCATTTCACAGCTCTAGTTGTTCAAACCAGTTTTTACAGCCTCCTGGATGGG
----S--L--S--L--V--L--R--A--A--S--Y--F--K--L--V--P--F--H--S--S--S--C--S--N--Q--F--L--Q--P--P--G--W--

----------------------------------------------------------------------------------------------------
V--V--L--T--Q--T--L--V--L--L--H--F--E--R--F--S--Y--Q--N--V--P--K--S--A--Q--G--K--G--N--L--Q--P--E--T
TCGTCTTGACCCAAACTCTTGTGTTGTTACATTTTGAGAGGTTTTCATACCAGAATGTACCAAAAAGTGCACAAGGTAAAGGTAATTTACAGCCAGAAAC
::.::::::::.::::::::: ..:.:::..:::::::: ::.:::::::::::::::::::::::::.::::. ::.::::::::::: ::: :. :::
TCATCTTGACCTAAACTCTTGAACTATTATGTTTTGAGATGTCTTCATACCAGAATGTACCAAAAAGTACACAGCGTGAAGGTAATTTAAAGCAAATAAC
V--I--L--T--*--T--L--E--L--L--C--F--E--M--S--S--Y--Q--N--V--P--K--S--T--Q--R--E--G--N--L--K--Q--I--T

--------------------------------------------------------------------------------------------------->
--N--I-----H--L--F--H--F--L--T--F--P--K--Q--I--S--R--N--L--F--N--S--L--L--C--L--M--C--L--T--Y--F--*-
AAATATA---CATTTGTTTCATTTCTTGACTTTCCCTAAGCAGATAAGCAGAAACTTGTTTAACTCATTACTTTGTTTGATGTGTCTTACATATTTTTGA
:::.:.:    .:::.:::::: :::::::::: . ::::::::::::::::::::::.::::.:..:.:::::: :::.:::::               
AAACACAC--AGTTTATTTCATGTCTTGACTTTATGTAAGCAGATAAGCAGAAACTTGCTTAATTTGTCACTTTGGTTGGTGTGT---------------
--N--T--\--H--L--F--H--V--L--T--L--C--K--Q--I--S--R--N--L--L--N--L--S--L--W--L--V--C----------------

Pig Consensus Sequence

>BGISUST0000900114
---TCTCTAAGCTTGGTGCTTAGAGCCGCTTCATATTTTAAACTAGTTCCATTTCACAGCTCTAGTTGTTCAAACCAGTTTTTACAGCCTCCTGGATGGG
TCATCTTGACCTAAACTCTTGAACTATTATGTTTTGAGATGTCTTCATACCAGAATGTACCAAAAAGTACACAGCGTGAAGGTAATTTAAAGCAAATAAC
AAAccACAGTTTATTTCATGTCTTGACTTTATGTAAGCAGATAAGCAGAAACTTGCTTAATTTGTCACTTTGGTTGGTG------------


>BGISUSP0000900114
-SLSLVLRAASYFKLVPFHSSSCSNQFLQPPGWVILT*TLELLCFEMSSYQNVPKSTQREGNLKQITNHSLFHVLTLCKQISRNLLNLSLWLV----