Sequences
EST Library Info
med1Mediastinum
nep2Newborn 115 days, epidermis
Clusters
Oligos
SNPs

Gene ID ENSG00000162650 (click for geneview)
Transcript ID ENST00000294668(link to ensembl)
Symbol ATXN7L2
Localtion Chromosome:1:109738603:109747396:1 band: 1p13.3
Description ataxin 7-like 2 [Source:RefSeq_peptide;Acc:NP_699171]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--V--R--E--R--A--A--A--A--M--A--A--L--E--R--R--V--P--S--L--D--D--F--A--G--Q--S--W--S--S--W--V--
ATGGCGGTGCGTGAACGCGCGGCGGCAGCAATGGCCGCTCTGGAGCGGCGGGTGCCGAGTCTCGATGACTTCGCGGGACAGAGCTGGAGCTCGTGGGTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------><-------------------------------------------------------------------><---
E--R--A--D--L--P--A--A--D--G--A--E--L--E--E--S--S--K--N--T--K--K--L--D--A--M--T--L--I--K--E--D--M--S
AGCGGGCCGACCTGCCCGCGGCTGACGGGGCTGAGCTGGAGGAGAGTAGCAAAAACACGAAGAAGTTGGATGCCATGACCCTCATTAAAGAAGACATGTC
                             ::::::.::::::::::.:. :::::::.::::::::::::::::::::::::::::::::::   :::::
-----------------------------GCTGAGTTGGAGGAGAGCAA-AAAAACATGAAGAAGTTGGATGCCATGACCCTCATTAAAGAA---ATGTC
------------------------------A--E--L--E--E--S--T--K--N--M--K--K--L--D--A--M--T--L--I--K--E-----M--S

----------------------------------------------------------------------------------------------------
--I--F--G--H--C--P--A--H--D--D--F--Y--L--V--V--C--N--H--C--S--Q--V--V--K--P--Q--A--F--Q--K--H--C--E-
CATCTTCGGGCACTGCCCTGCCCATGATGACTTCTACTTGGTTGTGTGTAACCACTGCAGCCAAGTGGTGAAGCCTCAAGCTTTCCAGAAGCACTGCGAA
::::::::::::::::::::::::::::::::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::   
CATCTTCGGGCACTGCCCTGCCCATGATGACTTCTATTTGGTTGTGTGTAACCATTGCAGCCAAGTGGTGAAGCCTCAAGCTTTCCAGAAGCACTGC---
--I--F--G--H--C--P--A--H--D--D--F--Y--L--V--V--C--N--H--C--S--Q--V--V--K--P--Q--A--F--Q--K--H--C----

><--------------------------------------------------------------------------------------------------
-R--R--H--G--P--L--S--K--L--Y--G--R--A--P--P--P--P--P--A--P--A--S--S--Q--K--C--H--V--V--N--G--Q--G--
AGAAGACATGGGCCCCTCAGCAAGCTTTATGGCCGGGCCCCACCCCCACCTCCAGCCCCTGCCAGCTCTCAGAAATGCCATGTAGTGAATGGGCAGGGCC
   :.. :.::::::::::::::::::::.: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
---AAGAACGGGCCCCTCAGCAAGCTTTACGCCCGGGCCCCACCCCCACCTCCAGCCCCTGCCAGCTCTCAGAAATGCCATGTAGTGAATGGGCAGGGCC
----K--N--G--P--L--S--K--L--Y--A--R--A--P--P--P--P--P--A--P--A--S--S--Q--K--C--H--V--V--N--G--Q--G--

----------------------------------------------------------------------------------------------------
P--A--C--R--A--P--G--S--T--K--T--S--S--R--E--K--G--Q--G--S--R--S--R--G--H--Q--P--P--E--K--T--Q--K--D
CAGCTTGTAGGGCCCCAGGTTCCACGAAAACCTCCTCCAGGGAGAAGGGCCAGGGGTCCCGGAGCCGTGGCCACCAGCCTCCTGAGAAGACCCAGAAGGA
:: :::..::::::.:: ::::::: :::::::::: ::.::::::::::::::::::::.:::::::::::::::::::::.:::::::::::.::.::
CATCTTACAGGGCCTCACGTTCCACCAAAACCTCCTACAAGGAGAAGGGCCAGGGGTCCCAGAGCCGTGGCCACCAGCCTCCCGAGAAGACCCAAAAAGA
P--S--Y--R--A--S--R--S--T--K--T--S--Y--K--E--K--G--Q--G--S--Q--S--R--G--H--Q--P--P--E--K--T--Q--K--D

-----------><---------------------------------------------------------------------------------------
--N--L--C--Q--P--G--G--L--T--K--D--S--P--G--K--P--P--M--A--P--P--S--K--E--P--P--G--R--E--N--I--E--I-
CAACCTCTGCCAGCCAGGGGGCCTCACCAAGGACTCCCCTGGAAAACCTCCCATGGCTCCCCCTTCTAAAGAACCTCCTGGCAGAGAGAACATCGAGATC
:::::::   :::::::: .:::::.::::::::::::::::::::  .:::::::: :::::::::::::::::::::::::::::...:::.::::: 
CAACCTC---CAGCCAGGCAGCCTCGCCAAGGACTCCCCTGGAAAAAACCCCATGGCACCCCCTTCTAAAGAACCTCCTGGCAGAGAAGGCATTGAGATA
--N--L-----Q--P--G--S--L--A--K--D--S--P--G--K--N--P--M--A--P--P--S--K--E--P--P--G--R--E--G--I--E--I-

----------------------------------------------------------------------------------------------------
-I--P--S--E--G--S--S--H--W--A--E--G--S--P--P--E--K--E--P--S--G--T--R--L--P--P--K--T--H--R--K--M--A--
ATCCCCAGTGAGGGGTCCAGTCACTGGGCTGAAGGCAGCCCTCCTGAAAAGGAGCCCAGTGGGACCAGGCTGCCCCCTAAAACCCACCGGAAGATGGCTC
:.::::::.::::: .. ::::::.::::::::::::::::.::::::::::::::..:::::: :::::::::::::::::::::::::::::::::: 
ACCCCCAGCGAGGGCCTGAGTCACCGGGCTGAAGGCAGCCCCCCTGAAAAGGAGCCTGGTGGGAACAGGCTGCCCCCTAAAACCCACCGGAAGATGGCT-
-T--P--S--E--G--L--S--H--R--A--E--G--S--P--P--E--K--E--P--G--G--N--R--L--P--P--K--T--H--R--K--M--A--

--><---------------------------------------------------------------------------------><-------------
R--K--E--C--D--L--N--R--Q--C--G--V--I--N--P--E--T--K--K--I--C--T--R--L--L--T--C--K--I--H--S--V--H--Q
GGAAGGAGTGCGACCTCAACAGGCAGTGTGGGGTAATAAATCCAGAGACCAAAAAGATCTGTACCCGCCTGTTGACCTGCAAGATCCACTCAGTACACCA
                                                                                   ::::::::.::.:::::
-----------------------------------------------------------------------------------ATCCACTCGGTGCACCA
------------------------------------------------------------------------------------I--H--S--V--H--Q

----------------------------------------------------------------------------------------------------
--R--R--E--V--Q--G--R--A--K--D--F--D--V--L--V--A--E--L--K--A--N--S--R--K--G--E--S--P--K--E--K--S--P-
GCGCCGGGAAGTCCAGGGCCGGGCCAAGGACTTTGACGTGCTGGTGGCAGAGCTGAAGGCCAACTCCCGCAAAGGGGAGTCTCCCAAGGAGAAGAGCCCA
:::::::::.::.::::::::.::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::
GCGCCGGGAGGTTCAGGGCCGAGCCAAGGACTTTGACGTGCTGGTGGCAGAGCTGAAGGCCAGCTCCCGCAAAGGGGAGTCTCCCAAGGAGAAGAGCCCA
--R--R--E--V--Q--G--R--A--K--D--F--D--V--L--V--A--E--L--K--A--S--S--R--K--G--E--S--P--K--E--K--S--P-

----------------------------------------------------------------------------------------------------
-G--R--K--E--Q--V--L--E--R--P--S--Q--E--L--P--S--S--V--Q--V--V--A--A--V--A--A--P-----S--S--T--F--S--
GGGCGCAAGGAGCAAGTTCTCGAGCGCCCCTCCCAGGAGCTCCCCTCCTCAGTCCAGGTTGTAGCAGCGGTGGCTGCTCCC---AGCAGCACCTTCTCTG
::::::::::::: ::.:::::::::::::::::::::::.:::::::::::::::::. ::.:::::.:.::::::::::    :::::::::::::::
GGGCGCAAGGAGCCAGCTCTCGAGCGCCCCTCCCAGGAGCCCCCCTCCTCAGTCCAGGCAGTGGCAGCAGCGGCTGCTCCCG--TGCAGCACCTTCTCTG
-G--R--K--E--P--A--L--E--R--P--S--Q--E--P--P--S--S--V--Q--A--V--A--A--A--A--A--P--\--G--S--T--F--S--

------------------------------------------><--------------------------------------------------------
V--R--A--K--Q--T--Y--P--Y--C--A--L--P--R--S--R--A--S--S--E--S--E--L--D--D--E--G--P--C--G--G--D--G--D
TTCGTGCCAAGCAGACCTACCCATACTGTGCACTGCCCAGGTCCCGGGCCTCCTCCGAGAGTGAATTGGATGATGAAGGCCCCTGTGGTGGTGATGGGGA
..::::::::::::::::::::::::::::::::::::   ::::::::::::::.::::::::.::::::: .::::::::. ::::::::::::::::
CCCGTGCCAAGCAGACCTACCCATACTGTGCACTGCCC---TCCCGGGCCTCCTCTGAGAGTGAGTTGGATGCCGAAGGCCCTGGTGGTGGTGATGGGGA
A--R--A--K--Q--T--Y--P--Y--C--A--L--P-----S--R--A--S--S--E--S--E--L--D--A--E--G--P--G--G--G--D--G--D

----------------------------------------------------------------------------------------------------
--P--G--L--F--P--F--P--M--P--R--G--G--T--Q--A--S--S--E--E--S--E--E--E--G--T--S--D--D--L--H--P--P--P-
CCCAGGCCTGTTCCCCTTCCCCATGCCCCGGGGTGGGACCCAGGCCTCCAGCGAAGAGAGTGAGGAGGAGGGGACATCTGACGACCTCCACCCACCCCCT
::::::::::::.::::::::: :::::::::: :::.:::::::::::::.::.:::::.::::::::::: ::::::::::::::::.::. ::: ::
CCCAGGCCTGTTTCCCTTCCCCCTGCCCCGGGGGGGGGCCCAGGCCTCCAGTGAGGAGAGCGAGGAGGAGGGCACATCTGACGACCTCCGCCTCCCCACT
--P--G--L--F--P--F--P--L--P--R--G--G--A--Q--A--S--S--E--E--S--E--E--E--G--T--S--D--D--L--R--L--P--T-

-----------------------------------------><---------------------------------------------------------
-D--C--H--Y--A--T--R--P--P--R--P--Q--A--F--C--T--F--G--S--R--L--V--S--P--G--C--Y--V--F--S--R--R--L--
GACTGCCATTATGCAACCCGGCCCCCACGGCCACAGGCGTTCTGCACCTTTGGGAGCCGGCTGGTGAGCCCAGGATGCTATGTGTTTAGCCGCCGGCTGG
::::::::.::::::: ::::::::: ::::::::::::::::::::::::::.::::::::::::::.:: ::::::::.:::::.:::::::::::::
GACTGCCACTATGCAAGCCGGCCCCCTCGGCCACAGGCGTTCTGCACCTTTGGAAGCCGGCTGGTGAGTCCTGGATGCTACGTGTTCAGCCGCCGGCTGG
-D--C--H--Y--A--S--R--P--P--R--P--Q--A--F--C--T--F--G--S--R--L--V--S--P--G--C--Y--V--F--S--R--R--L--

---------------------------------------------------------------><-----------------------------------
D--R--F--C--S--A--L--S--S--M--L--E--R--H--L--S--T--H--M--W--K--K--I--P--P--A--A--E--P--P--A--H--L--V
ACCGGTTCTGCTCAGCACTCAGCTCCATGCTGGAACGGCACCTCAGCACACACATGTGGAAGAAGATCCCACCGGCAGCTGAACCTCCAGCTCACCTTGT
::::::::::::::::::: ::::::::::::::.:::::.:::::: :::::::::::                                         
ACCGGTTCTGCTCAGCACTGAGCTCCATGCTGGAGCGGCATCTCAGCTCACACATGTGG-----------------------------------------
D--R--F--C--S--A--L--S--S--M--L--E--R--H--L--S--S--H--M--W------------------------------------------

----------------------------------------------------------------------------------------------------
--N--S--P--L--S--A--P--L--S--P--S--S--T--G--T--C--P--R--L--P--G--P--T--L--R--P--A--C--P--A--S--M--P-
CAACTCCCCGTTATCTGCTCCCCTGAGCCCATCCTCTACAGGCACCTGCCCCCGCCTTCCAGGTCCAACCCTGAGACCTGCCTGCCCAGCCTCCATGCCC
                         ::::::::::::.:..::: ::::::::: ::::::::.::: :::. :::::.:::::::::::::::::::::
-------------------------AGCCCATCCTCTGCGAGCAGCTGCCCCCGGCTTCCAGGCCCACCCCCTAGACCCGCCTGCCCAGCCTCCATGCCC
--------------------------S--P--S--S--A--S--S--C--P--R--L--P--G--P--P--P--R--P--A--C--P--A--S--M--P-

-----------------------------------------------------------------------------------><---------------
-P--T--K--D--N--L--V--P--S--Y--P--A--G--S--P--S--V--A--A--A--C--S--Q--A--E--C--M--E--P--G--Y--H--L--
CCCACCAAGGACAACCTTGTCCCCAGCTACCCTGCAGGCTCCCCCAGCGTGGCGGCTGCCTGTAGCCAGGCAGAGTGCATGGAGCCAGGCTATCACCTCA
::..:::::::::.::: ::.::::::::::::::::::::::::::.:::::.::.:::::.::::::::.::.::::::   ::::::::::::::::
CCTGCCAAGGACAGCCTAGTTCCCAGCTACCCTGCAGGCTCCCCCAGTGTGGCAGCCGCCTGCAGCCAGGCGGAATGCATG---CCAGGCTATCACCTCA
-P--A--K--D--S--L--V--P--S--Y--P--A--G--S--P--S--V--A--A--A--C--S--Q--A--E--C--M-----P--G--Y--H--L--

----------------------------------------------------------------------------------------------------
T--T--A--C--Q--H--A--I--P--V--L--Q--Q--A--A--A--F--Q--G--Q--Q--V--I--Q--R--Q--G--R--G--G--G--G--G--P
CCACTGCCTGCCAACACGCCATCCCCGTCCTTCAGCAAGCTGCCGCCTTCCAAGGCCAGCAAGTCATCCAAAGGCAAGGACGGGGTGGAGGTGGAGGCCC
::::::::::::::::::::.:::::::::::: ::::::: :::::::::::::::::::::::.:::::::::::::::: . : :::::::::::.:
CCACTGCCTGCCAACACGCCGTCCCCGTCCTTCTGCAAGCTCCCGCCTTCCAAGGCCAGCAAGTCGTCCAAAGGCAAGGACGCACTTGAGGTGGAGGCTC
T--T--A--C--Q--H--A--V--P--V--L--L--Q--A--P--A--F--Q--G--Q--Q--V--V--Q--R--Q--G--R--T--*--G--G--G--S

-------------------------------------------
--F--S--K--A--E--V--I--P--W--P--Y--H--S--*-
CTTCTCGAAAGCGGAAGTTATCCCCTGGCCCTACCACTCTTAA
:::::::::::::::::::::::::::::::.:::::      
CTTCTCGAAAGCGGAAGTTATCCCCTGGCCCCACCAC------
--F--S--K--A--E--V--I--P--W--P--H--H-------

Pig Consensus Sequence

>BGISUST0000887443
----------------------------------------------------------------------------------------------------
-----------------------------GCTGAGTTGGAGGAGAGcaAAAACATGAAGAAGTTGGATGCCATGACCCTCATTAAAGAA---ATGTCCAT
CTTCGGGCACTGCCCTGCCCATGATGACTTCTATTTGGTTGTGTGTAACCATTGCAGCCAAGTGGTGAAGCCTCAAGCTTTCCAGAAGCACTGC------
AAGAACGGGCCCCTCAGCAAGCTTTACGCCCGGGCCCCACCCCCACCTCCAGCCCCTGCCAGCTCTCAGAAATGCCATGTAGTGAATGGGCAGGGCCCAT
CTTACAGGGCCTCACGTTCCACCAAAACCTCCTACAAGGAGAAGGGCCAGGGGTCCCAGAGCCGTGGCCACCAGCCTCCCGAGAAGACCCAAAAAGACAA
CCTC---CAGCCAGGCAGCCTCGCCAAGGACTCCCCTGGAAAAAACCCCATGGCACCCCCTTCTAAAGAACCTCCTGGCAGAGAAGGCATTGAGATAACC
CCCAGCGAGGGCCTGAGTCACCGGGCTGAAGGCAGCCCCCCTGAAAAGGAGCCTGGTGGGAACAGGCTGCCCCCTAAAACCCACCGGAAGATGGCT----
--------------------------------------------------------------------------------ATCCACTCGGTGCACCAGCG
CCGGGAGGTTCAGGGCCGAGCCAAGGACTTTGACGTGCTGGTGGCAGAGCTGAAGGCCAGCTCCCGCAAAGGGGAGTCTCCCAAGGAGAAGAGCCCAGGG
CGCAAGGAGCCAGCTCTCGAGCGCCCCTCCCAGGAGCCCCCCTCCTCAGTCCAGGCAGTGGCAGCAGCGGCTGCTCCctGCAGCACCTTCTCTGCCCGTG
CCAAGCAGACCTACCCATACTGTGCACTGCCC---TCCCGGGCCTCCTCTGAGAGTGAGTTGGATGCCGAAGGCCCTGGTGGTGGTGATGGGGACCCAGG
CCTGTTTCCCTTCCCCCTGCCCCGGGGGGGGGCCCAGGCCTCCAGTGAGGAGAGCGAGGAGGAGGGCACATCTGACGACCTCCGCCTCCCCACTGACTGC
CACTATGCAAGCCGGCCCCCTCGGCCACAGGCGTTCTGCACCTTTGGAAGCCGGCTGGTGAGTCCTGGATGCTACGTGTTCAGCCGCCGGCTGGACCGGT
TCTGCTCAGCACTGAGCTCCATGCTGGAGCGGCATCTCAGCTCACACATGTGG-----------------------------------------------
-------------------AGCCCATCCTCTGCGAGCAGCTGCCCCCGGCTTCCAGGCCCACCCCCTAGACCCGCCTGCCCAGCCTCCATGCCCCCTGCC
AAGGACAGCCTAGTTCCCAGCTACCCTGCAGGCTCCCCCAGTGTGGCAGCCGCCTGCAGCCAGGCGGAATGCATG---CCAGGCTATCACCTCACCACTG
CCTGCCAACACGCCGTCCCCGTCCTTCTGCAAGCTCCCGCCTTCCAAGGCCAGCAAGTCGTCCAAAGGCAAGGACGCACTTGAGGTGGAGGCTCCTTCTC
GAAAGCGGAAGTTATCCCCTGGCCCCACCAC------


>BGISUSP0000887443
-------------------------------------------AELEESKNMKKLDAMTLIKE-MSIFGHCPAHDDFYLVVCNHCSQVVKPQAFQKHC--
KNGPLSKLYARAPPPPPAPASSQKCHVVNGQGPSYRASRSTKTSYKEKGQGSQSRGHQPPEKTQKDNL-QPGSLAKDSPGKNPMAPPSKEPPGREGIEIT
PSEGLSHRAEGSPPEKEPGGNRLPPKTHRKMA----------------------------IHSVHQRREVQGRAKDFDVLVAELKASSRKGESPKEKSPG
RKEPALERPSQEPPSSVQAVAAAAAPCSTFSARAKQTYPYCALP-SRASSESELDAEGPGGGDGDPGLFPFPLPRGGAQASSEESEEEGTSDDLRLPTDC
HYASRPPRPQAFCTFGSRLVSPGCYVFSRRLDRFCSALSSMLERHLSSHMW----------------------SPSSASSCPRLPGPPPRPACPASMPPA
KDSLVPSYPAGSPSVAAACSQAECM-PGYHLTTACQHAVPVLLQAPAFQGQQVVQRQGRT*GGGSFSKAEVIPWPHH--