Sequences
EST Library Info
pgl1Pituitary gland
plac1Unavailable
ski2Skin
spc1Spinal cord
tes1Testes
thg1Thyroid gland
Clusters
Oligos
SNPs

Gene ID ENSG00000162980 (click for geneview)
Transcript ID ENST00000295087(link to ensembl)
Symbol ARL5
Localtion Chromosome:2:152484612:152510503:-1 band: 2q23.3
Description ADP-ribosylation factor-like protein 5. [Source:Uniprot/SWISSPROT;Acc:Q9Y689]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------><-----------------------------------------------------
-M--G--I--L--F--T--R--I--W--R--L--F--N--H--Q--E--H--K--V--I--I--V--G--L--D--N--A--G--K--T--T--I--L--
ATGGGAATTCTCTTCACTAGAATATGGAGACTGTTCAATCACCAGGAGCACAAAGTTATCATTGTTGGGCTGGATAATGCAGGGAAAACTACCATTCTTT
   ::.:::::::::::.::.::::::::::::::::::::::::   :::::::::::::::::::::::::::::::::::.:::::::::::.::::
---GGGATTCTCTTCACCAGGATATGGAGACTGTTCAATCACCAG---CACAAAGTTATCATTGTTGGGCTGGATAATGCAGGAAAAACTACCATCCTTT
----G--I--L--F--T--R--I--W--R--L--F--N--H--Q-----H--K--V--I--I--V--G--L--D--N--A--G--K--T--T--I--L--

------><--------------------------------------------------------------------------------------------
Y--Q--F--S--M--N--E--V--V--H--T--S--P--T--I--G--S--N--V--E--E--I--V--I--N--N--T--R--F--L--M--W--D--I
ACCAATTTTCTATGAATGAAGTTGTACATACATCTCCTACAATAGGAAGTAATGTAGAAGAGATAGTGATTAATAATACACGTTTCCTAATGTGGGATAT
::      :::::::::::::::::::::::.::.::::::::::::::::::::::::::::::::.:::::::::::::::::.::.:::::::::::
AC------TCTATGAATGAAGTTGTACATACGTCCCCTACAATAGGAAGTAATGTAGAAGAGATAGTAATTAATAATACACGTTTTCTGATGTGGGATAT
Y--------S--M--N--E--V--V--H--T--S--P--T--I--G--S--N--V--E--E--I--V--I--N--N--T--R--F--L--M--W--D--I

------------------------------------------------------><--------------------------------------------
--G--G--Q--E--S--L--R--S--S--W--N--T--Y--Y--T--N--T--E--F--V--I--V--V--V--D--S--T--D--R--E--R--I--S-
TGGTGGCCAAGAATCTCTTCGTTCTTCCTGGAACACTTACTATACTAACACAGAGTTTGTAATAGTTGTTGTGGACAGTACAGACAGAGAGAGGATTTCT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::
TGGTGGCCAAGAATCTCTTCGTTCTTCCTGGAACACTTACTATACTAACACAGAGTTTGTAATAGTTGTTGTGGACAGTACAGACAGAGAAAGGATTTCT
--G--G--Q--E--S--L--R--S--S--W--N--T--Y--Y--T--N--T--E--F--V--I--V--V--V--D--S--T--D--R--E--R--I--S-

--------------------------------------><------------------------------------------------------------
-V--T--R--E--E--L--Y--K--M--L--A--H--E--D--L--R--K--A--G--L--L--I--F--A--N--K--Q--D--V--K--E--C--M--
GTAACTAGAGAAGAACTCTATAAAATGTTAGCGCATGAGGACCTAAGAAAAGCTGGATTGCTGATTTTTGCTAATAAACAAGATGTTAAAGAATGCATGA
:::::::::::::::::.:::::::::::.:: ::::::::.:::::.:::::::::::::::::.::::::::::::::::::::::::::::::::::
GTAACTAGAGAAGAACTTTATAAAATGTTGGCCCATGAGGATCTAAGGAAAGCTGGATTGCTGATCTTTGCTAATAAACAAGATGTTAAAGAATGCATGA
-V--T--R--E--E--L--Y--K--M--L--A--H--E--D--L--R--K--A--G--L--L--I--F--A--N--K--Q--D--V--K--E--C--M--

------------------------------------------------------------------------------------------><--------
T--V--A--E--I--S--Q--F--L--K--L--T--S--I--K--D--H--Q--W--H--I--Q--A--C--C--A--L--T--G--E--G--L--C--Q
CTGTAGCAGAAATCTCCCAGTTTTTGAAGCTAACTTCTATTAAAGATCACCAGTGGCATATCCAGGCATGCTGTGCTCTAACTGGCGAGGGATTGTGCCA
::::::::::::::::::::::::::::.::::::::::::::.::::::::::::::::::::::::::::::::::: :::::::::   ::.:::::
CTGTAGCAGAAATCTCCCAGTTTTTGAAACTAACTTCTATTAAGGATCACCAGTGGCATATCCAGGCATGCTGTGCTCTTACTGGCGAG---TTATGCCA
T--V--A--E--I--S--Q--F--L--K--L--T--S--I--K--D--H--Q--W--H--I--Q--A--C--C--A--L--T--G--E-----L--C--Q

--------------------------------------->
--G--L--E--W--M--M--S--R--L--K--I--R--*-
AGGACTTGAATGGATGATGTCACGACTTAAGATTAGATGA
::::::::::::::::::::::::::::::::::::::::
AGGACTTGAATGGATGATGTCACGACTTAAGATTAGATGA
--G--L--E--W--M--M--S--R--L--K--I--R--*-

Pig Consensus Sequence

>BGISUST0000891124
---GGGATTCTCTTCACCAGGATATGGAGACTGTTCAATCACCAG---CACAAAGTTATCATTGTTGGGCTGGATAATGCAGGAAAAACTACCATCCTTT
AC------TCTATGAATGAAGTTGTACATACGTCCCCTACAATAGGAAGTAATGTAGAAGAGATAGTAATTAATAATACACGTTTTCTGATGTGGGATAT
TGGTGGCCAAGAATCTCTTCGTTCTTCCTGGAACACTTACTATACTAACACAGAGTTTGTAATAGTTGTTGTGGACAGTACAGACAGAGAAAGGATTTCT
GTAACTAGAGAAGAACTTTATAAAATGTTGGCCCATGAGGATCTAAGGAAAGCTGGATTGCTGATCTTTGCTAATAAACAAGATGTTAAAGAATGCATGA
CTGTAGCAGAAATCTCCCAGTTTTTGAAACTAACTTCTATTAAGGATCACCAGTGGCATATCCAGGCATGCTGTGCTCTTACTGGCGAG---TTATGCCA
AGGACTTGAATGGATGATGTCACGACTTAAGATTAGATGA


>BGISUSP0000891124
-GILFTRIWRLFNHQ-HKVIIVGLDNAGKTTILY--SMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERIS
VTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGE-LCQGLEWMMSRLKIR*