Sequences
EST Library Info
cbe1Cerebellum
cmu1Rhinal mucous membrane - RNA from China
fat1Fatt
gul1Gullet
hea2Heart
lyg1Lymphatic gland
mga3Mammary gland - 7 days after weaning
nca4Newborn 115 days, cartillage
ova1Ovary
pan4Pancreas
pgl2Pituitary gland
rec5Rectum
sin1Small intestine
ski1Skin
thg2Thyroid gland
Clusters
Oligos
SNPs

Gene ID ENSG00000162997 (click for geneview)
Transcript ID ENST00000295112(link to ensembl)
Symbol XP_293034.1
Localtion Chromosome:2:55421141:55423212:1 band: 2p16.1
Description PREDICTED: similar to RIKEN cDNA 2010316F05
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------------------><------------------
-A--G--A--E--L--G--A--A--L--E--Q--R--L--G--A--L--A--I--H--T--E--V--V--E--H--P--E--L--F--T--V--E--E--
GCGGGCGCGGAGTTGGGAGCGGCGCTCGAGCAGCGGCTCGGTGCCCTGGCCATCCACACTGAGGTCGTGGAGCACCCCGAGCTATTTACAGTTGAAGAAA
   ::: :.:::::: : :::::::: ::::::::::::.:::::::::::::::.::: :::.::::::::::::: :::   ::::::::::::::::
---GGCTCAGAGTTGCGCGCGGCGCTGGAGCAGCGGCTCAGTGCCCTGGCCATCCGCACAGAGATCGTGGAGCACCCGGAG---TTTACAGTTGAAGAAA
----G--S--E--L--R--A--A--L--E--Q--R--L--S--A--L--A--I--R--T--E--I--V--E--H--P--E-----F--T--V--E--E--

----------------------------------------------------------------------------------------------------
M--M--P--H--I--Q--H--L--K--G--A--H--S--K--N--L--F--L--K--D--K--K--K--K--N--Y--W--L--V--T--V--L--H--D
TGATGCCTCATATTCAACATCTGAAAGGAGCACATAGTAAGAACTTATTTCTTAAAGACAAAAAGAAAAAGAATTATTGGCTGGTGACAGTTCTTCATGA
:::::::::::::.::::::.:::::::::::::::::::::::::::::::::::::::::::::::::....::::::::::::::::::::::::::
TGATGCCTCATATCCAACATTTGAAAGGAGCACATAGTAAGAACTTATTTCTTAAAGACAAAAAGAAAAAAGGCTATTGGCTGGTGACAGTTCTTCATGA
M--M--P--H--I--Q--H--L--K--G--A--H--S--K--N--L--F--L--K--D--K--K--K--K--G--Y--W--L--V--T--V--L--H--D

----------------------------------------------------------------------------------------------------
--R--Q--I--N--L--N--E--L--A--K--Q--L--G--V--G--S--G--N--L--R--F--A--D--E--T--A--M--L--E--K--L--K--V-
TAGACAAATTAATTTAAATGAGCTTGCCAAGCAGTTAGGTGTTGGGAGTGGAAATCTGCGATTTGCTGATGAAACAGCCATGCTAGAAAAACTAAAAGTT
:::::::::.::::::::::: ::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::.::::::
TAGACAAATCAATTTAAATGATCTTGCCAAGCAGTTAGGTGTTGGGAGTGGAAATCTGCGGTTTGCTGATGAAACAGCCATGCTAGAAAAACTGAAAGTT
--R--Q--I--N--L--N--D--L--A--K--Q--L--G--V--G--S--G--N--L--R--F--A--D--E--T--A--M--L--E--K--L--K--V-

----------------------------------------------------------------------------------------------------
-G--Q--G--C--A--T--P--L--A--L--F--C--D--G--G--D--V--K--F--V--L--D--S--A--F--L--E--G--G--H--E--K--V--
GGTCAAGGCTGTGCCACACCCTTGGCACTTTTCTGTGATGGTGGAGATGTGAAGTTTGTTCTGGATTCTGCTTTTCTCGAAGGTGGACATGAAAAGGTGT
: .::::::::::: ::::: ::::::::.::::::::::.::::::::::::.::::::::::::::::::::::: ::::::::::::::::::::.:
GTCCAAGGCTGTGCGACACCATTGGCACTCTTCTGTGATGATGGAGATGTGAAATTTGTTCTGGATTCTGCTTTTCTGGAAGGTGGACATGAAAAGGTAT
-V--Q--G--C--A--T--P--L--A--L--F--C--D--D--G--D--V--K--F--V--L--D--S--A--F--L--E--G--G--H--E--K--V--

----------------------------------------------------------------------------------------------------
Y--F--H--P--M--T--N--A--A--T--M--G--L--S--P--E--D--F--L--T--F--V--K--M--T--G--H--D--P--I--I--L--N--F
ACTTTCATCCAATGACCAATGCTGCAACCATGGGATTGAGCCCTGAAGACTTTCTCACATTTGTGAAGATGACAGGACATGATCCCATAATACTAAATTT
:::::::::::::::::::..::::::::::::::.::::::::::::::::::::::::::::.::::  :::::::::::::::::::::::::::::
ACTTTCATCCAATGACCAACACTGCAACCATGGGACTGAGCCCTGAAGACTTTCTCACATTTGTAAAGAACACAGGACATGATCCCATAATACTAAATTT
Y--F--H--P--M--T--N--T--A--T--M--G--L--S--P--E--D--F--L--T--F--V--K--N--T--G--H--D--P--I--I--L--N--F

--->
--D-
TGAT
::::
TGAT
--D-

Pig Consensus Sequence

>BGISUST0000883191
---GGCTCAGAGTTGCGCGCGGCGCTGGAGCAGCGGCTCAGTGCCCTGGCCATCCGCACAGAGATCGTGGAGCACCCGGAG---TTTACAGTTGAAGAAA
TGATGCCTCATATCCAACATTTGAAAGGAGCACATAGTAAGAACTTATTTCTTAAAGACAAAAAGAAAAAAGGCTATTGGCTGGTGACAGTTCTTCATGA
TAGACAAATCAATTTAAATGATCTTGCCAAGCAGTTAGGTGTTGGGAGTGGAAATCTGCGGTTTGCTGATGAAACAGCCATGCTAGAAAAACTGAAAGTT
GTCCAAGGCTGTGCGACACCATTGGCACTCTTCTGTGATGATGGAGATGTGAAATTTGTTCTGGATTCTGCTTTTCTGGAAGGTGGACATGAAAAGGTAT
ACTTTCATCCAATGACCAACACTGCAACCATGGGACTGAGCCCTGAAGACTTTCTCACATTTGTAAAGAACACAGGACATGATCCCATAATACTAAATTT
TGAT


>BGISUSP0000883191
-GSELRAALEQRLSALAIRTEIVEHPE-FTVEEMMPHIQHLKGAHSKNLFLKDKKKKGYWLVTVLHDRQINLNDLAKQLGVGSGNLRFADETAMLEKLKV
VQGCATPLALFCDDGDVKFVLDSAFLEGGHEKVYFHPMTNTATMGLSPEDFLTFVKNTGHDPIILNFD