Sequences
AJ946930est
rgul0106_n3.y1est
DY428134est
AJ958817est
rpliv0136_d5.y1est
rlin38_d20.y1est
rpgl21_p5.y1est
rpliv0130_j11.y1est
BQ599215est
rlin26_l18r1.y1est
rpliv0109_g16.y1est
BX667616est
rpliv0130_j14.y1est
CN164072est
rste14_b7.y1est
rnco1926b_h16.y1est
rsin35_m4.y1est
DY424039est
AJ654574est
rtes19_e24.y1est
rdpaxb0_034419.y1reads
DN114591est
rgul0102_d1.y1est
rlin28_i20.y1est
rbdc_21636.y1reads
rdbla0116_e5.y1est
rtes26_j4.y1est
rpliv0110_k20.y1est
AJ954600est
rbyb_85003.y1reads
BW955741est
CF794642est
rpfco0140_j21.y1est
rthg16_d24.y1est
rfat0113_p11.y1est
rtra17_m4r1.y1est
rthg09_i15.y1est
BX673648est
rtes16_p21.y1est
rlyg09_c18.y1est
rbyd_71246.y1reads
BP159423est
AJ659201est
rlin39_b24.y1est
rspc032_l1.y1est
DN114944est
rspl37_f19.y1est
BX666287est
rcbl0_005275.y1est
rnbm37b_j19.y1est
AJ687205est
rret18_a17.y1est
BW961039est
rfbs3930b_c23.y1est
rova028_o23.y1est
rcly17b_o2.y1est
rspl01_k18.y1est
CR883767reads
rret10_a11.y1est
rpliv0114_p22.y1est
BQ600334est
rplac_1420.y1est
rlyg32_o7.y1est
risp15_i17.y1est
rfbs3915b_j7.y1est
rlin21_o12.y1est
ruio04_k14.y1est
rtes27_a8.y1est
rpigcb_11906.y1est
raor019_g3.y1est
rspc033_j21.y1est
rpldo0107_p1.y1est
rtes37_i7r1.y1est
rspc035_i3.y1est
AJ958734est
rlin25_l3.y1est
rgul0107_f15.y1est
rlin02_i8.y1est
rmgp35_c18.y1est
rpldo0115_e21.y1est
bda_43549.z1reads
CB475513est
rgul0109_d21.y1est
rpigcb_15002.y1est
rspl39_f7.y1est
rnco1912b_b16.y1est
rthg16_b11.y1est
BI327318est
DV897417est
rski0117_o17.y1est
rpliv0116_a19.y1est
rgul0107_e5.y1est
rste34_a1.y1est
bla_94464.z1reads
AJ647041est
rfat0128_f14.y1est
rpliv0134_h6.y1est
rtra27_e19r1.y1est
rrec17_d10.y1est
rpliv0126_k2.y1est
rsin16_i5.y1est
AJ955230est
rsme032_o20.y1est
rlin05_p9r1.y1est
rdpbxa0_050930.y1reads
rtra16_o23r1.y1est
rpigcf0_004353.y1est
CN159002est
dpbxa0_065432.z1reads
EST Library Info
aor1Aorta
cbl1Blood
cly3Lymph - RNA from China
dbla2Unavailable
fat4Fatt
fbs2Unavailable
gul6Gullet
isp1M. Infraspinatus
lin10Large intestine
lyg2Lymphatic gland
mgp3Mammary gland - 7 days pre birth
nbm1Newborn 115 days, bone marrow (pelvis)
nco5Newborn 115 days, colon
ova2Ovary
pfco1Unavailable
pgl1Pituitary gland
pigcb3Unavailable
pigcf1Unavailable
plac1Unavailable
pldo4Unavailable
pliv17Unavailable
ret2Retina
sin3Small intestine
ski1Skin
sme3M. Semimembranosus
spc3Spinal cord
spl4Spleen
ste3M. Semitendinosus
tes8Testes
thg2Thyroid gland
tra4Trachea
uio2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000109606 (click for geneview)
Transcript ID ENST00000295561(link to ensembl)
Symbol NP_001349.1
Localtion Chromosome:4:24205763:24262446:-1 band: 4p15.2
Description DEAH (Asp-Glu-Ala-His) box polypeptide 15
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------><----------------------------
-M--S--K--R--H--R--L--D--L--G--E--D--Y--P--S--G--K--K--R--A--G--T--D--G--K--D--R--D--R--D--R--D--R--
ATGTCCAAGCGGCACCGGTTGGACCTAGGGGAGGATTACCCCTCTGGCAAGAAGCGTGCGGGGACCGATGGGAAGGATCGAGATCGAGACCGGGATCGTG
:::::.:::::.::::::::::::::.:::::::::::::::::.::::::::::::::::::::::::   :::::: ::::::: ::::: :::::::
ATGTCTAAGCGACACCGGTTGGACCTGGGGGAGGATTACCCCTCCGGCAAGAAGCGTGCGGGGACCGAT---AAGGATAGAGATCGTGACCGTGATCGTG
-M--S--K--R--H--R--L--D--L--G--E--D--Y--P--S--G--K--K--R--A--G--T--D-----K--D--R--D--R--D--R--D--R--

----------------------------------------------------------------------------------------------------
E--D--R--S--K--D--R--D--R--E--R--D--R--G--D--R--E--R--E--R--E--K--E--K--E--K--E--L--R--A--S--T--N--A
AAGATCGGTCTAAAGATCGAGACCGAGAACGTGATAGAGGAGATAGAGAGCGAGAGAGGGAGAAAGAAAAGGAGAAGGAGTTGCGAGCTTCAACAAATGC
::::::::::::::::: ::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::..::::::::::.::.:::::
AAGATCGGTCTAAAGATAGAGACCGAGAACGTGATAGAGGAGATAGAGAGCGGGAGAGGGAGAAAGAAAAGGAGAAGGAACTGCGAGCTTCGACGAATGC
E--D--R--S--K--D--R--D--R--E--R--D--R--G--D--R--E--R--E--R--E--K--E--K--E--K--E--L--R--A--S--T--N--A

----------------------------------------------------------------------------------------------------
--M--L--I--S--A--G--L--P--P--L--K--A--S--H--S--A--H--S--T--H--S--A--H--S--T--H--S--T--H--S--A--H--S-
TATGCTTATCAGTGCTGGATTACCACCTTTGAAAGCTTCCCATTCAGCTCACTCAACCCACTCAGCACATTCAACGCATTCAACACATTCTGCTCATTCA
::::::.:::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::.:.::::::::::::::::::::::::
TATGCTCATCAGTGCTGGATTACCACCTTTAAAAGCTTCCCATTCAGCTCACTCAACCCACTCAGCACATTCAGCACATTCAACACATTCTGCTCATTCA
--M--L--I--S--A--G--L--P--P--L--K--A--S--H--S--A--H--S--T--H--S--A--H--S--A--H--S--T--H--S--A--H--S-

----------------------------------------------------------------------------------------------------
-T--H--A--G--H--A--G--H--T--S--L--P--Q--C--I--N--P--F--T--N--L--P--H--T--P--R--Y--Y--D--I--L--K--K--
ACGCATGCCGGACATGCAGGTCACACGTCACTTCCACAGTGCATTAATCCGTTCACCAACTTACCCCATACTCCTCGATACTATGATATTCTAAAGAAAC
::.::..::::.:::::::: :::::.:::::::::::::::::::::::.::.::::::::.:: :::::.::::::::::::::::::::::::::::
ACACACACCGGGCATGCAGGACACACATCACTTCCACAGTGCATTAATCCATTTACCAACTTGCCACATACCCCTCGATACTATGATATTCTAAAGAAAC
-T--H--T--G--H--A--G--H--T--S--L--P--Q--C--I--N--P--F--T--N--L--P--H--T--P--R--Y--Y--D--I--L--K--K--

----------------------------------------------------------------------------------------------------
R--L--Q--L--P--V--W--E--Y--K--D--R--F--T--D--I--L--V--R--H--Q--S--F--V--L--V--G--E--T--G--S--G--K--T
GTCTTCAGCTCCCTGTTTGGGAATACAAGGATAGGTTTACAGATATTCTGGTTAGACATCAGTCCTTTGTACTGGTTGGTGAGACTGGGTCTGGTAAAAC
: ::::::::::::::::::::::::::.:::::.::::::::::::::::::::::::::::::::::: :: ::::::::::::::::::::::::::
GGCTTCAGCTCCCTGTTTGGGAATACAAAGATAGATTTACAGATATTCTGGTTAGACATCAGTCCTTTGTTCTTGTTGGTGAGACTGGGTCTGGTAAAAC
R--L--Q--L--P--V--W--E--Y--K--D--R--F--T--D--I--L--V--R--H--Q--S--F--V--L--V--G--E--T--G--S--G--K--T

------><--------------------------------------------------------------------------------------------
--T--Q--I--P--Q--W--C--V--E--Y--M--R--S--L--P--G--P--K--R--G--V--A--C--T--Q--P--R--R--V--A--A--M--S-
AACACAGATTCCACAGTGGTGTGTGGAGTACATGCGATCATTACCAGGACCCAAGAGAGGAGTTGCCTGTACCCAACCCAGGAGAGTGGCTGCAATGAGT
::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::
AACACAGATTCCACAGTGGTGTGTGGAGTACATGCGATCATTACCAGGACCCAAAAGAGGAGTTGCCTGTACCCAACCCAGGAGAGTGGCTGCAATGAGT
--T--Q--I--P--Q--W--C--V--E--Y--M--R--S--L--P--G--P--K--R--G--V--A--C--T--Q--P--R--R--V--A--A--M--S-

----------------------------------------------------------------------------------------------------
-V--A--Q--R--V--A--D--E--M--D--V--M--L--G--Q--E--V--G--Y--S--I--R--F--E--D--C--S--S--A--K--T--I--L--
GTGGCTCAGAGAGTTGCTGATGAGATGGATGTGATGTTGGGCCAGGAAGTTGGTTACTCCATTCGATTTGAAGACTGCAGTAGTGCAAAAACCATTCTTA
:::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 
GTGGCTCAGAGAGTTGCTGATGAAATGGATGTGATGTTGGGCCAGGAAGTTGGTTACTCCATTCGATTTGAAGACTGCAGTAGTGCAAAAACCATTCTT-
-V--A--Q--R--V--A--D--E--M--D--V--M--L--G--Q--E--V--G--Y--S--I--R--F--E--D--C--S--S--A--K--T--I--L--

><--------------------------------------------------------------------------------------------------
K--Y--M--T--D--G--M--L--L--R--E--A--M--N--D--P--L--L--E--R--Y--G--V--I--I--L--D--E--A--H--E--R--T--L
AGTATATGACTGATGGGATGTTACTTCGTGAAGCTATGAATGATCCCCTCCTGGAGCGTTATGGTGTAATAATTCTTGATGAGGCTCATGAGAGGACACT
  :::::::::::::: :::::::::::::::::::::::::::::.:::.::::::::::.:::::::: ::::::::::::::::::::.::::::.:
--TATATGACTGATGGCATGTTACTTCGTGAAGCTATGAATGATCCTCTCTTGGAGCGTTACGGTGTAATCATTCTTGATGAGGCTCATGAAAGGACATT
---Y--M--T--D--G--M--L--L--R--E--A--M--N--D--P--L--L--E--R--Y--G--V--I--I--L--D--E--A--H--E--R--T--L

------------------------------------------------------------><--------------------------------------
--A--T--D--I--L--M--G--V--L--K--E--V--V--R--Q--R--S--D--L--K--V--I--V--M--S--A--T--L--D--A--G--K--F-
GGCTACAGATATTCTAATGGGTGTTCTGAAGGAAGTTGTAAGACAGAGATCAGATTTAAAGGTTATAGTTATGAGCGCTACTCTAGATGCAGGAAAATTC
::::::::::::::: ::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::
GGCTACAGATATTCTCATGGGTGTTCTGAAGGAAGTTGTTAGACAGAGATCAGATTTAAAGGTTATAGTTATGAGTGCTACTCTAGATGCAGGAAAATTC
--A--T--D--I--L--M--G--V--L--K--E--V--V--R--Q--R--S--D--L--K--V--I--V--M--S--A--T--L--D--A--G--K--F-

----------------------------------------------------------------------------------------------------
-Q--I--Y--F--D--N--C--P--L--L--T--I--P--G--R--T--H--P--V--E--I--F--Y--T--P--E--P--E--R--D--Y--L--E--
CAGATTTACTTTGATAACTGTCCTCTCCTAACTATTCCTGGGCGTACACATCCTGTTGAGATCTTCTATACTCCAGAACCAGAGAGAGATTATCTTGAAG
:::::::::::::::::::::::::::.:::::::.:::::::::::::::::::::::::::::.::::::::.::::::::::::::::::::.::::
CAGATTTACTTTGATAACTGTCCTCTCTTAACTATCCCTGGGCGTACACATCCTGTTGAGATCTTTTATACTCCGGAACCAGAGAGAGATTATCTCGAAG
-Q--I--Y--F--D--N--C--P--L--L--T--I--P--G--R--T--H--P--V--E--I--F--Y--T--P--E--P--E--R--D--Y--L--E--

-------------------------------------------------------------------------------><-------------------
A--A--I--R--T--V--I--Q--I--H--M--C--E--E--E--E--G--D--L--L--L--F--L--T--G--Q--E--E--I--D--E--A--C--K
CAGCAATTCGAACAGTTATCCAGATTCATATGTGTGAAGAGGAAGAGGGAGATCTTCTTCTTTTCTTAACTGGTCAAGAGGAAATTGATGAAGCCTGTAA
::::::::::.::::: :::::.::::::::::::::::::::.:::::::::::::: :::::::::::::::::::::::::::::::::::::::::
CAGCAATTCGGACAGTGATCCAAATTCATATGTGTGAAGAGGAGGAGGGAGATCTTCTACTTTTCTTAACTGGTCAAGAGGAAATTGATGAAGCCTGTAA
A--A--I--R--T--V--I--Q--I--H--M--C--E--E--E--E--G--D--L--L--L--F--L--T--G--Q--E--E--I--D--E--A--C--K

----------------------------------------------------------------------------------------------------
--R--I--K--R--E--V--D--D--L--G--P--E--V--G--D--I--K--I--I--P--L--Y--S--T--L--P--P--Q--Q--Q--Q--R--I-
GAGAATAAAGCGTGAAGTTGATGATTTGGGCCCTGAAGTTGGTGACATTAAAATCATTCCATTGTATTCTACACTTCCACCTCAGCAGCAGCAACGCATT
:::::::::::::::.::::::::.::.::.:::::::::::.:::::::::::::::::::::::.::::::::.::::::::::::::::::::::::
GAGAATAAAGCGTGAGGTTGATGACTTAGGTCCTGAAGTTGGCGACATTAAAATCATTCCATTGTACTCTACACTCCCACCTCAGCAGCAGCAACGCATT
--R--I--K--R--E--V--D--D--L--G--P--E--V--G--D--I--K--I--I--P--L--Y--S--T--L--P--P--Q--Q--Q--Q--R--I-

-----------------------------------------------><---------------------------------------------------
-F--E--P--P--P--P--K--K--Q--N--G--A--I--G--R--K--V--V--V--S--T--N--I--A--E--T--S--L--T--I--D--G--V--
TTTGAGCCTCCACCTCCCAAAAAACAGAATGGAGCAATTGGAAGAAAGGTAGTTGTGTCAACTAACATAGCAGAGACGTCTTTGACAATAGATGGTGTGG
::::::::::::::::: :::::::::::.::::::::::::::::::::::::::::::::.::::: ::::::::.::::::::::::::::::::.:
TTTGAGCCTCCACCTCCAAAAAAACAGAACGGAGCAATTGGAAGAAAGGTAGTTGTGTCAACCAACATTGCAGAGACATCTTTGACAATAGATGGTGTAG
-F--E--P--P--P--P--K--K--Q--N--G--A--I--G--R--K--V--V--V--S--T--N--I--A--E--T--S--L--T--I--D--G--V--

----------------------------------><----------------------------------------------------------------
V--F--V--I--D--P--G--F--A--K--Q--K--V--Y--N--P--R--I--R--V--E--S--L--L--V--T--A--I--S--K--A--S--A--Q
TGTTTGTGATTGATCCTGGATTTGCGAAACAGAAGGTCTACAATCCTCGAATCAGAGTTGAGTCCCTTTTGGTGACAGCTATTAGTAAAGCTTCAGCTCA
:.:::::::::::::::::::::::.:::::.::::: ::::::::::::::::::::.:::::::::::.::::::::.::::::::::::::::::::
TATTTGTGATTGATCCTGGATTTGCAAAACAAAAGGTGTACAATCCTCGAATCAGAGTCGAGTCCCTTTTAGTGACAGCCATTAGTAAAGCTTCAGCTCA
V--F--V--I--D--P--G--F--A--K--Q--K--V--Y--N--P--R--I--R--V--E--S--L--L--V--T--A--I--S--K--A--S--A--Q

------------------------------------------------------------------------------------><--------------
--Q--R--A--G--R--A--G--R--T--R--P--G--K--C--F--R--L--Y--T--E--K--A--Y--K--T--E--M--Q--D--N--T--Y--P-
GCAAAGGGCTGGTCGAGCTGGACGTACCAGACCTGGAAAATGCTTCAGACTTTACACAGAGAAAGCTTATAAAACAGAAATGCAGGATAACACCTATCCT
.:::::::::::::::::::::::::::::::::::.::::::::::::::.::.::.:::::::::::.::::::::::::::::::::.:::::::::
ACAAAGGGCTGGTCGAGCTGGACGTACCAGACCTGGGAAATGCTTCAGACTCTATACGGAGAAAGCTTACAAAACAGAAATGCAGGATAATACCTATCCT
--Q--R--A--G--R--A--G--R--T--R--P--G--K--C--F--R--L--Y--T--E--K--A--Y--K--T--E--M--Q--D--N--T--Y--P-

---------------------------------------------------------------------------------------------><-----
-E--I--L--R--S--N--L--G--S--V--V--L--Q--L--K--K--L--G--I--D--D--L--V--H--F--D--F--M--D--P--P--A--P--
GAGATTTTGCGTTCTAATTTAGGATCAGTTGTGTTACAATTGAAGAAACTTGGTATTGATGACTTGGTACATTTTGATTTTATGGATCCACCAGCTCCTG
:::::::::::::::::::::::::::::::::.::::.:::::::::::::::::::::::.:::::::::::::::::::::::.::::::   ::::
GAGATTTTGCGTTCTAATTTAGGATCAGTTGTGCTACAGTTGAAGAAACTTGGTATTGATGATTTGGTACATTTTGATTTTATGGACCCACCA---CCTG
-E--I--L--R--S--N--L--G--S--V--V--L--Q--L--K--K--L--G--I--D--D--L--V--H--F--D--F--M--D--P--P-----P--

----------------------------------------------------------------------------------------------------
E--T--L--M--R--A--L--E--L--L--N--Y--L--A--A--L--N--D--D--G--D--L--T--E--L--G--S--M--M--A--E--F--P--L
AAACTCTGATGAGAGCCCTGGAACTTTTGAATTACCTGGCTGCTTTAAATGATGATGGAGATCTGACTGAATTGGGATCCATGATGGCAGAGTTTCCTCT
::::::: :::::::::::.:::::.::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::::
AAACTCTCATGAGAGCCCTAGAACTCTTGAATTATCTGGCTGCTTTAAATGATGATGGAGATCTGACTGAATTGGGATCCATGATGGCTGAGTTTCCTCT
E--T--L--M--R--A--L--E--L--L--N--Y--L--A--A--L--N--D--D--G--D--L--T--E--L--G--S--M--M--A--E--F--P--L

-------------------------------------------------------------------------------------><-------------
--D--P--Q--L--A--K--M--V--I--A--S--C--D--Y--N--C--S--N--E--V--L--S--I--T--A--M--L--S--V--P--Q--C--F-
AGATCCACAGCTCGCAAAAATGGTTATTGCAAGTTGTGACTACAACTGTTCTAATGAGGTCCTATCTATTACTGCTATGTTGTCAGTCCCACAGTGTTTT
::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   ::::::::::::
AGATCCACAGCTCGCTAAAATGGTTATTGCAAGTTGTGACTACAACTGTTCTAATGAGGTCCTATCTATTACTGCTATGTTGTCA---CCACAGTGTTTT
--D--P--Q--L--A--K--M--V--I--A--S--C--D--Y--N--C--S--N--E--V--L--S--I--T--A--M--L--S-----P--Q--C--F-

----------------------------------------------------------------------------------------------------
-V--R--P--T--E--A--K--K--A--A--D--E--A--K--M--R--F--A--H--I--D--G--D--H--L--T--L--L--N--V--Y--H--A--
GTTCGCCCCACGGAGGCCAAGAAAGCCGCAGATGAGGCCAAGATGAGATTTGCCCACATAGATGGAGATCATCTGACACTGCTGAACGTCTACCATGCTT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::
GTTCGCCCCACGGAGGCCAAGAAAGCCGCAGATGAGGCCAAGATGAGATTTGCCCACATAGATGGAGATCATCTGACACTGCTGAATGTCTACCATGCTT
-V--R--P--T--E--A--K--K--A--A--D--E--A--K--M--R--F--A--H--I--D--G--D--H--L--T--L--L--N--V--Y--H--A--

--------><------------------------------------------------------------------------------------------
F--K--Q--N--H--E--S--V--Q--W--C--Y--D--N--F--I--N--Y--R--S--L--M--S--A--D--N--V--R--Q--Q--L--S--R--I
TTAAACAAAATCATGAATCGGTTCAGTGGTGTTATGACAACTTCATTAACTACAGGTCCCTGATGTCCGCAGACAATGTACGCCAGCAGCTATCTCGAAT
::::::::   ::::::::.::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::  ::::
TTAAACAA---CATGAATCAGTTCAGTGGTGTTATGACAACTTCATTAACTACAGGTCCCTGATGTCAGCAGACAATGTACGCCAGCAGCTATCGAGAAT
F--K--Q-----H--E--S--V--Q--W--C--Y--D--N--F--I--N--Y--R--S--L--M--S--A--D--N--V--R--Q--Q--L--S--R--I

--------------------------------------------------------------------------------------------------->
--M--D--R--F--N--L--P--R--R--S--T--D--F--T--S--R--D--Y--Y--I--N--I--R--K--A--L--V--T--G--Y--F--M--Q-
TATGGACAGATTTAATTTGCCTCGTCGAAGTACTGACTTTACAAGCAGGGACTATTATATTAATATAAGAAAAGCTTTGGTTACTGGGTATTTTATGCAG
::::::::::::::::::::::::::::::::::::.::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TATGGACAGATTTAATTTGCCTCGTCGAAGTACTGATTTCACAAGCAGGGACTATTATATTAATATAAGAAAAGCTTTGGTTACTGGGTATTTTATGCAG
--M--D--R--F--N--L--P--R--R--S--T--D--F--T--S--R--D--Y--Y--I--N--I--R--K--A--L--V--T--G--Y--F--M--Q-

<---------------------------------------------------------------------------------------------------
-V--A--H--L--E--R--T--G--H--Y--L--T--V--K--D--N--Q--V--V--Q--L--H--P--S--T--V--L--D--H--K--P--E--W--
GTGGCACATTTAGAACGAACAGGGCATTACTTAACTGTGAAAGATAACCAGGTGGTTCAGTTGCATCCCTCTACTGTTCTTGACCACAAACCTGAATGGG
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::
GTGGCACATTTAGAACGAACAGGGCATTACTTAACTGTGAAAGATAACCAGGTGGTTCAGTTGCATCCCTCTACTGTTCTTGACCACAAGCCTGAATGGG
-V--A--H--L--E--R--T--G--H--Y--L--T--V--K--D--N--Q--V--V--Q--L--H--P--S--T--V--L--D--H--K--P--E--W--

---------------------------------------------------------------------><-----------------------------
V--L--Y--N--E--F--V--L--T--T--K--N--Y--I--R--T--C--T--D--I--K--P--E--W--L--V--K--I--A--P--Q--Y--Y--D
TGCTTTATAATGAGTTTGTTCTAACAACAAAGAATTACATCCGGACATGTACAGATATCAAGCCAGAATGGTTGGTGAAAATTGCCCCTCAATATTATGA
::::::::::.::::::::::: :::::.::::::::::::::::::::::::::::::::::: :::   :::::::::::::::::::::::::::::
TGCTTTATAACGAGTTTGTTCTCACAACGAAGAATTACATCCGGACATGTACAGATATCAAGCCTGAA---TTGGTGAAAATTGCCCCTCAATATTATGA
V--L--Y--N--E--F--V--L--T--T--K--N--Y--I--R--T--C--T--D--I--K--P--E-----L--V--K--I--A--P--Q--Y--Y--D

---------------------------------------------------><-----------------------------------------------
--M--S--N--F--P--Q--C--E--A--K--R--Q--L--D--R--I--I--Q--T--S--I--Q--G--I--F--T--V--L--N--S--V--L--R-
CATGAGCAATTTCCCACAGTGTGAAGCAAAGAGACAGTTGGACCGCATCATTCAAACTTCAATCCAAGGAATATTCACAGTACTGAATTCAGTGCTTAGA
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::::::::.::::::::
CATGAGCAATTTCCCACAGTGTGAAGCAAAGAGACAGTTGGACCGCATCATTCAAACTGCAATCCAAGGAATATTCACAGTACTGAATTCAATGCTTAGA
--M--S--N--F--P--Q--C--E--A--K--R--Q--L--D--R--I--I--Q--T--A--I--Q--G--I--F--T--V--L--N--S--M--L--R-

-------------------------------------->
-T--E--V--I--E--R--T--A--L--K--D--E--*-
ACTGAAGTTATTGAGAGGACAGCTTTAAAAGATGAATGA
:::::::::::: ::::::::::::::::::::::::::
ACTGAAGTTATTCAGAGGACAGCTTTAAAAGATGAATGA
-T--E--V--I--Q--R--T--A--L--K--D--E--*-

Pig Consensus Sequence

>BGISUST0000896035
ATGTCTAAGCGACACCGGTTGGACCTGGGGGAGGATTACCCCTCCGGCAAGAAGCGTGCGGGGACCGAT---AAGGATAGAGATCGTGACCGTGATCGTG
AAGATCGGTCTAAAGATAGAGACCGAGAACGTGATAGAGGAGATAGAGAGCGGGAGAGGGAGAAAGAAAAGGAGAAGGAACTGCGAGCTTCGACGAATGC
TATGCTCATCAGTGCTGGATTACCACCTTTAAAAGCTTCCCATTCAGCTCACTCAACCCACTCAGCACATTCAGCACATTCAACACATTCTGCTCATTCA
ACACACACCGGGCATGCAGGACACACATCACTTCCACAGTGCATTAATCCATTTACCAACTTGCCACATACCCCTCGATACTATGATATTCTAAAGAAAC
GGCTTCAGCTCCCTGTTTGGGAATACAAAGATAGATTTACAGATATTCTGGTTAGACATCAGTCCTTTGTTCTTGTTGGTGAGACTGGGTCTGGTAAAAC
AACACAGATTCCACAGTGGTGTGTGGAGTACATGCGATCATTACCAGGACCCAAAAGAGGAGTTGCCTGTACCCAACCCAGGAGAGTGGCTGCAATGAGT
GTGGCTCAGAGAGTTGCTGATGAAATGGATGTGATGTTGGGCCAGGAAGTTGGTTACTCCATTCGATTTGAAGACTGCAGTAGTGCAAAAACCATTCTT-
--TATATGACTGATGGCATGTTACTTCGTGAAGCTATGAATGATCCTCTCTTGGAGCGTTACGGTGTAATCATTCTTGATGAGGCTCATGAAAGGACATT
GGCTACAGATATTCTCATGGGTGTTCTGAAGGAAGTTGTTAGACAGAGATCAGATTTAAAGGTTATAGTTATGAGTGCTACTCTAGATGCAGGAAAATTC
CAGATTTACTTTGATAACTGTCCTCTCTTAACTATCCCTGGGCGTACACATCCTGTTGAGATCTTTTATACTCCGGAACCAGAGAGAGATTATCTCGAAG
CAGCAATTCGGACAGTGATCCAAATTCATATGTGTGAAGAGGAGGAGGGAGATCTTCTACTTTTCTTAACTGGTCAAGAGGAAATTGATGAAGCCTGTAA
GAGAATAAAGCGTGAGGTTGATGACTTAGGTCCTGAAGTTGGCGACATTAAAATCATTCCATTGTACTCTACACTCCCACCTCAGCAGCAGCAACGCATT
TTTGAGCCTCCACCTCCAAAAAAACAGAACGGAGCAATTGGAAGAAAGGTAGTTGTGTCAACCAACATTGCAGAGACATCTTTGACAATAGATGGTGTAG
TATTTGTGATTGATCCTGGATTTGCAAAACAAAAGGTGTACAATCCTCGAATCAGAGTCGAGTCCCTTTTAGTGACAGCCATTAGTAAAGCTTCAGCTCA
ACAAAGGGCTGGTCGAGCTGGACGTACCAGACCTGGGAAATGCTTCAGACTCTATACGGAGAAAGCTTACAAAACAGAAATGCAGGATAATACCTATCCT
GAGATTTTGCGTTCTAATTTAGGATCAGTTGTGCTACAGTTGAAGAAACTTGGTATTGATGATTTGGTACATTTTGATTTTATGGACCCACCA---CCTG
AAACTCTCATGAGAGCCCTAGAACTCTTGAATTATCTGGCTGCTTTAAATGATGATGGAGATCTGACTGAATTGGGATCCATGATGGCTGAGTTTCCTCT
AGATCCACAGCTCGCTAAAATGGTTATTGCAAGTTGTGACTACAACTGTTCTAATGAGGTCCTATCTATTACTGCTATGTTGTCA---CCACAGTGTTTT
GTTCGCCCCACGGAGGCCAAGAAAGCCGCAGATGAGGCCAAGATGAGATTTGCCCACATAGATGGAGATCATCTGACACTGCTGAATGTCTACCATGCTT
TTAAACAA---CATGAATCAGTTCAGTGGTGTTATGACAACTTCATTAACTACAGGTCCCTGATGTCAGCAGACAATGTACGCCAGCAGCTATCGAGAAT
TATGGACAGATTTAATTTGCCTCGTCGAAGTACTGATTTCACAAGCAGGGACTATTATATTAATATAAGAAAAGCTTTGGTTACTGGGTATTTTATGCAG
GTGGCACATTTAGAACGAACAGGGCATTACTTAACTGTGAAAGATAACCAGGTGGTTCAGTTGCATCCCTCTACTGTTCTTGACCACAAGCCTGAATGGG
TGCTTTATAACGAGTTTGTTCTCACAACGAAGAATTACATCCGGACATGTACAGATATCAAGCCTGAA---TTGGTGAAAATTGCCCCTCAATATTATGA
CATGAGCAATTTCCCACAGTGTGAAGCAAAGAGACAGTTGGACCGCATCATTCAAACTGCAATCCAAGGAATATTCACAGTACTGAATTCAATGCTTAGA
ACTGAAGTTATTCAGAGGACAGCTTTAAAAGATGAATGA


>BGISUSP0000896035
MSKRHRLDLGEDYPSGKKRAGTD-KDRDRDRDREDRSKDRDRERDRGDREREREKEKEKELRASTNAMLISAGLPPLKASHSAHSTHSAHSAHSTHSAHS
THTGHAGHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSFVLVGETGSGKTTQIPQWCVEYMRSLPGPKRGVACTQPRRVAAMS
VAQRVADEMDVMLGQEVGYSIRFEDCSSAKTIL-YMTDGMLLREAMNDPLLERYGVIILDEAHERTLATDILMGVLKEVVRQRSDLKVIVMSATLDAGKF
QIYFDNCPLLTIPGRTHPVEIFYTPEPERDYLEAAIRTVIQIHMCEEEEGDLLLFLTGQEEIDEACKRIKREVDDLGPEVGDIKIIPLYSTLPPQQQQRI
FEPPPPKKQNGAIGRKVVVSTNIAETSLTIDGVVFVIDPGFAKQKVYNPRIRVESLLVTAISKASAQQRAGRAGRTRPGKCFRLYTEKAYKTEMQDNTYP
EILRSNLGSVVLQLKKLGIDDLVHFDFMDPP-PETLMRALELLNYLAALNDDGDLTELGSMMAEFPLDPQLAKMVIASCDYNCSNEVLSITAMLS-PQCF
VRPTEAKKAADEAKMRFAHIDGDHLTLLNVYHAFKQ-HESVQWCYDNFINYRSLMSADNVRQQLSRIMDRFNLPRRSTDFTSRDYYINIRKALVTGYFMQ
VAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVLYNEFVLTTKNYIRTCTDIKPE-LVKIAPQYYDMSNFPQCEAKRQLDRIIQTAIQGIFTVLNSMLR
TEVIQRTALKDE*