Sequences
EST Library Info
jca1Joint capsule
ret1Retina
tes1Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000163666 (click for geneview)
Transcript ID ENST00000295934(link to ensembl)
Symbol HESX1
Localtion Chromosome:3:57207265:57209320:-1 band: 3p14.3
Description Homeobox expressed in ES cells 1 (Homeobox protein ANF) (hAnf). [Source:Uniprot/SWISSPROT;Acc:Q9UBX0]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--P--S--L--Q--E--G--A--Q--L--G--E--N--K--P--S--T--C--S--F--S--I--E--R--I--L--G--L--D--Q--K--K--
ATGTCTCCCAGCCTTCAGGAAGGCGCTCAGCTCGGGGAAAACAAACCCTCAACTTGCTCCTTTTCAATTGAGAGAATCTTAGGACTGGACCAGAAGAAAG
:::::::::::::::::::::::.::::.:::.:  ::::.:::::::::: :.:::::::::::.:::::::: :::::::::::::::::::::::::
ATGTCTCCCAGCCTTCAGGAAGGTGCTCGGCTTGCCGAAAGCAAACCCTCACCCTGCTCCTTTTCGATTGAGAGCATCTTAGGACTGGACCAGAAGAAAG
-M--S--P--S--L--Q--E--G--A--R--L--A--E--S--K--P--S--P--C--S--F--S--I--E--S--I--L--G--L--D--Q--K--K--

--------------------------------------------------------><------------------------------------------
D--C--V--P--L--M--K--P--H--R--P--W--A--D--T--C--S--S--S--G--K--D--G--N--L--C--L--H--V--P--N--P--P--S
ACTGTGTTCCATTAATGAAACCCCACAGGCCCTGGGCAGACACCTGCAGCTCATCAGGGAAAGATGGTAACTTATGTCTACATGTCCCAAATCCTCCCAG
::::::::::::.::.::::::::::::::::::::::::.::::::::::: :::   ::::::: :::::: ::::::::.:::::.:.::.:::...
ACTGTGTTCCATCAACGAAACCCCACAGGCCCTGGGCAGATACCTGCAGCTCTTCA---AAAGATGTTAACTTTTGTCTACACGTCCCGAGTCTTCCTGA
D--C--V--P--S--T--K--P--H--R--P--W--A--D--T--C--S--S--S-----K--D--V--N--F--C--L--H--V--P--S--L--P--D

----------------------------------------------------------------------------------------------------
--G--I--S--F--P--S--V--V--D--H--P--M--P--E--E--R--A--S--K--Y--E--N--Y--F--S--A--S--E--R--L--S--L--K-
TGGGATTTCATTCCCTAGCGTGGTGGATCACCCAATGCCAGAAGAAAGAGCTTCGAAATATGAAAATTACTTTTCAGCCTCAGAAAGACTGTCTTTGAAA
:::.::.::::: ::: :..  :::::::::.::.:::::::::::.:::.::.:::::.:::::::::::::::::::::::::::::: :::::::::
TGGAATCTCATTACCTTGTAATGTGGATCACTCAGTGCCAGAAGAAGGAGTTTTGAAATGTGAAAATTACTTTTCAGCCTCAGAAAGACTTTCTTTGAAA
--G--I--S--L--P--C--N--V--D--H--S--V--P--E--E--G--V--L--K--C--E--N--Y--F--S--A--S--E--R--L--S--L--K-

--------------------------------------------------------><------------------------------------------
-R--E--L--S--W--Y--R--G--R--R--P--R--T--A--F--T--Q--N--Q--I--E--V--L--E--N--V--F--R--V--N--C--Y--P--
AGAGAGTTGAGTTGGTATAGAGGCCGAAGACCAAGAACTGCTTTTACTCAAAACCAGATTGAAGTGTTAGAAAATGTCTTTAGAGTAAACTGCTATCCTG
:::::.:::::::::::::::::::::::::: :::::::::::::: :::::::::::::::.::::.:::::::::::::::::::::::::::::::
AGAGAATTGAGTTGGTATAGAGGCCGAAGACCCAGAACTGCTTTTACGCAAAACCAGATTGAAATGTTGGAAAATGTCTTTAGAGTAAACTGCTATCCTG
-R--E--L--S--W--Y--R--G--R--R--P--R--T--A--F--T--Q--N--Q--I--E--M--L--E--N--V--F--R--V--N--C--Y--P--

----------------------------------------------------------><----------------------------------------
G--I--D--I--R--E--D--L--A--Q--K--L--N--L--E--E--D--R--I--Q--I--W--F--Q--N--R--R--A--K--L--K--R--S--H
GTATCGATATTAGAGAAGACTTAGCTCAAAAATTGAATCTAGAGGAAGACAGAATCCAGATTTGGTTTCAAAATCGGCGTGCAAAACTGAAAAGGTCCCA
:.::.:::::.::::::::::::::.:.:::::::::::::::.::.::.::::::::::: :::::.:::::::::::::::::.::::::::.:::::
GCATTGATATCAGAGAAGACTTAGCCCGAAAATTGAATCTAGAAGAGGATAGAATCCAGATATGGTTCCAAAATCGGCGTGCAAAGCTGAAAAGATCCCA
G--I--D--I--R--E--D--L--A--R--K--L--N--L--E--E--D--R--I--Q--I--W--F--Q--N--R--R--A--K--L--K--R--S--H

--------------------------------------------------------->
--R--E--S--Q--F--L--M--A--K--K--N--F--N--T--N--L--L--E--*-
TAGAGAATCACAGTTTCTAATGGCGAAAAAAAATTTCAACACAAATCTGCTGGAATAG
: ::::::::::.:::::::::::.:::::::.::::::::: .:::: :::::::::
TCGAGAATCACAATTTCTAATGGCAAAAAAAAGTTTCAACACTGATCTCCTGGAATAG
--R--E--S--Q--F--L--M--A--K--K--S--F--N--T--D--L--L--E--*-

Pig Consensus Sequence

>BGISUST0000885364
ATGTCTCCCAGCCTTCAGGAAGGTGCTCGGCTTGCCGAAAGCAAACCCTCACCCTGCTCCTTTTCGATTGAGAGCATCTTAGGACTGGACCAGAAGAAAG
ACTGTGTTCCATCAACGAAACCCCACAGGCCCTGGGCAGATACCTGCAGCTCTTCA---AAAGATGTTAACTTTTGTCTACACGTCCCGAGTCTTCCTGA
TGGAATCTCATTACCTTGTAATGTGGATCACTCAGTGCCAGAAGAAGGAGTTTTGAAATGTGAAAATTACTTTTCAGCCTCAGAAAGACTTTCTTTGAAA
AGAGAATTGAGTTGGTATAGAGGCCGAAGACCCAGAACTGCTTTTACGCAAAACCAGATTGAAATGTTGGAAAATGTCTTTAGAGTAAACTGCTATCCTG
GCATTGATATCAGAGAAGACTTAGCCCGAAAATTGAATCTAGAAGAGGATAGAATCCAGATATGGTTCCAAAATCGGCGTGCAAAGCTGAAAAGATCCCA
TCGAGAATCACAATTTCTAATGGCAAAAAAAAGTTTCAACACTGATCTCCTGGAATAG


>BGISUSP0000885364
MSPSLQEGARLAESKPSPCSFSIESILGLDQKKDCVPSTKPHRPWADTCSSS-KDVNFCLHVPSLPDGISLPCNVDHSVPEEGVLKCENYFSASERLSLK
RELSWYRGRRPRTAFTQNQIEMLENVFRVNCYPGIDIREDLARKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKSFNTDLLE*