Sequences
EST Library Info
pigca2Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000163694 (click for geneview)
Transcript ID ENST00000295971(link to ensembl)
Symbol Q8NI52_HUMAN
Localtion Chromosome:4:40268849:40357520:-1 band: 4p14
Description RNA-binding protein.
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--T--A--E--D--S--T--A--A--M--S--S--D--S--A--A--G--S--S--A--K--V--P--E--G--V--A--G--A--P--N--E--A--
ATGACCGCAGAGGATTCCACCGCAGCCATGAGCAGTGACTCGGCCGCCGGGTCCTCCGCCAAGGTGCCCGAGGGCGTGGCGGGCGCGCCCAACGAGGCAG
:::::::::::::::::::::::::::::::::::.::::: ::::::::.::::: ::::::::::::::::::::::::::::::::::::::::: :
ATGACCGCAGAGGATTCCACCGCAGCCATGAGCAGCGACTCCGCCGCCGGATCCTCGGCCAAGGTGCCCGAGGGCGTGGCGGGCGCGCCCAACGAGGCTG
-M--T--A--E--D--S--T--A--A--M--S--S--D--S--A--A--G--S--S--A--K--V--P--E--G--V--A--G--A--P--N--E--A--

----------------------------------------------------------------------------------------------------
A--L--L--A--L--M--E--R--T--G--Y--S--M--V--Q--E--N--G--Q--R--K--Y--G--G--P--P--P--G--W--E--G--P--H--P
CACTGCTGGCGCTGATGGAGCGCACGGGCTACAGCATGGTGCAAGAGAACGGGCAGCGCAAGTACGGCGGCCCACCGCCCGGCTGGGAGGGCCCGCACCC
:.::::::::::::::::::::::: ::.::::::::::::::.::::::::::::::::::::::: ::::: :::::::::::::: :::::::::::
CGCTGCTGGCGCTGATGGAGCGCACTGGTTACAGCATGGTGCAGGAGAACGGGCAGCGCAAGTACGGAGGCCCTCCGCCCGGCTGGGACGGCCCGCACCC
A--L--L--A--L--M--E--R--T--G--Y--S--M--V--Q--E--N--G--Q--R--K--Y--G--G--P--P--P--G--W--D--G--P--H--P

----------------------------------------------------------------------------------------------------
--Q--R--G--C--E--V--F--V--G--K--I--P--R--D--V--Y--E--D--E--L--V--P--V--F--E--A--V--G--R--I--Y--E--L-
GCAGCGTGGCTGCGAGGTCTTCGTGGGCAAGATCCCGCGCGACGTGTACGAGGACGAGCTGGTGCCCGTGTTCGAGGCCGTGGGCCGCATCTACGAGCTG
::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: :::::::::.: :::::.:::::::::::::: 
GCAGCGCGGCTGCGAGGTCTTCGTGGGCAAGATCCCGCGCGACGTGTACGAGGACGAGCTGGTGCCGGTGTTCGAGACGGTGGGTCGCATCTACGAGCTC
--Q--R--G--C--E--V--F--V--G--K--I--P--R--D--V--Y--E--D--E--L--V--P--V--F--E--T--V--G--R--I--Y--E--L-

----------------------------------------------------------------------------------------------------
-R--L--M--M--D--F--D--G--K--N--R--G--Y--A--F--V--M--Y--C--H--K--H--E--A--K--R--A--V--R--E--L--N--N--
CGCCTCATGATGGACTTTGACGGCAAGAACCGCGGCTACGCCTTCGTCATGTACTGCCACAAGCACGAGGCCAAGCGCGCAGTGCGTGAGCTCAACAACT
:::::::::::::::::.::.:::::::::::::::::::::::::::::::::::::::::: :::::::::::::::: :::::.:::::::::::::
CGCCTCATGATGGACTTCGATGGCAAGAACCGCGGCTACGCCTTCGTCATGTACTGCCACAAGAACGAGGCCAAGCGCGCCGTGCGCGAGCTCAACAACT
-R--L--M--M--D--F--D--G--K--N--R--G--Y--A--F--V--M--Y--C--H--K--N--E--A--K--R--A--V--R--E--L--N--N--

----------------------------------------------------------------------------------------------------
Y--E--I--R--P--G--R--L--L--G--V--C--C--S--V--D--N--C--R--L--F--I--G--G--I--P--K--M--K--K--R--E--E--I
ACGAGATCCGCCCGGGCCGCCTGCTCGGCGTGTGCTGCAGCGTGGACAACTGCCGCCTCTTCATCGGCGGGATCCCCAAGATGAAGAAGCGCGAGGAAAT
:::::::::: :: ::::::::::: ::::::::::::::::: :::::::::::::::::::::::.:: ::::::::::::::::::::::::::.::
ACGAGATCCGGCCCGGCCGCCTGCTGGGCGTGTGCTGCAGCGTTGACAACTGCCGCCTCTTCATCGGTGGCATCCCCAAGATGAAGAAGCGCGAGGAGAT
Y--E--I--R--P--G--R--L--L--G--V--C--C--S--V--D--N--C--R--L--F--I--G--G--I--P--K--M--K--K--R--E--E--I

----------------------------------------------------------------------------------------------------
--L--E--E--I--A--K--V--T--E--G--V--L--D--V--I--V--Y--A--S--A--A--D--K--M--K--N--R--G--F--A--F--V--E-
CCTGGAGGAGATTGCCAAGGTCACCGAGGGCGTGCTGGACGTGATCGTCTACGCCAGCGCGGCCGACAAGATGAAGAACCGCGGCTTCGCCTTCGTGGAG
::::::.:::::.::::::::::: ::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCTGGAAGAGATCGCCAAGGTCACGGAGGGCGTGCTCGACGTGATCGTCTACGCCAGCGCGGCCGACAAGATGAAGAACCGCGGCTTCGCCTTCGTGGAG
--L--E--E--I--A--K--V--T--E--G--V--L--D--V--I--V--Y--A--S--A--A--D--K--M--K--N--R--G--F--A--F--V--E-

----------------------------------------------------------------------------------------------------
-Y--E--S--H--R--A--A--A--M--A--R--R--K--L--M--P--G--R--I--Q--L--W--G--H--Q--I--A--V--D--W--A--E--P--
TACGAGAGCCACCGCGCGGCTGCCATGGCTCGCCGCAAGCTCATGCCTGGCCGCATCCAGCTGTGGGGCCACCAGATCGCCGTGGACTGGGCCGAACCTG
::::::::::::::::: ::::: ::::: :::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.::.:
TACGAGAGCCACCGCGCCGCTGCGATGGCGCGCCGCAAGCTCATGCCCGGCCGCATCCAGCTGTGGGGCCACCAGATCGCCGTGGACTGGGCCGAGCCCG
-Y--E--S--H--R--A--A--A--M--A--R--R--K--L--M--P--G--R--I--Q--L--W--G--H--Q--I--A--V--D--W--A--E--P--

----------------------------------------------------------------------------------------------------
E--I--D--V--D--E--D--V--M--E--T--V--K--I--L--Y--V--R--N--L--M--I--E--T--T--E--D--T--I--K--K--S--F--G
AGATCGACGTGGACGAGGACGTGATGGAGACCGTGAAGATCCTCTACGTGCGCAACCTCATGATCGAGACCACCGAGGACACCATCAAGAAGAGCTTCGG
:::: ::::::::::::::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::
AGATAGACGTGGACGAGGACGTGATGGAGACCGTGAAGATCCTCTACGTGCGGAACCTCATGATCGAGACCACCGAGGACACCATCAAGAAGAGCTTCGG
E--I--D--V--D--E--D--V--M--E--T--V--K--I--L--Y--V--R--N--L--M--I--E--T--T--E--D--T--I--K--K--S--F--G

----------------------------------------------------------------------------------------------------
--Q--F--N--P--G--C--V--E--R--V--K--K--I--R--D--Y--A--F--V--H--F--T--S--R--E--D--A--V--H--A--M--N--N-
CCAGTTCAACCCCGGCTGCGTGGAGCGCGTCAAGAAGATCCGCGACTACGCCTTCGTGCACTTCACCAGCCGCGAGGATGCCGTGCATGCCATGAACAAC
:::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::..:::::::::::::.::::::::.::::::::::::
CCAGTTCAATCCCGGCTGCGTGGAGCGCGTCAAGAAGATCCGCGACTACGCCTTCGTGCACTTTGCCAGCCGCGAGGACGCCGTGCACGCCATGAACAAC
--Q--F--N--P--G--C--V--E--R--V--K--K--I--R--D--Y--A--F--V--H--F--A--S--R--E--D--A--V--H--A--M--N--N-

----------------------------------------------------------------------------------------------------
-L--N--G--T--E--L--E--G--S--C--L--E--V--T--L--A--K--P--V--D--K--E--Q--Y--S--R--Y--Q--K--A--A--R--G--
CTCAACGGCACTGAGCTGGAGGGCTCGTGCCTGGAGGTCACGCTGGCCAAGCCCGTGGACAAGGAGCAGTACTCGCGCTACCAGAAGGCAGCCAGGGGCG
:::::::::::::::::::::::::::::::: ::::: ::::::::.::::: :::::::::::::::::::: :::::::::::::::::::.:::::
CTCAACGGCACTGAGCTGGAGGGCTCGTGCCTCGAGGTGACGCTGGCTAAGCCGGTGGACAAGGAGCAGTACTCCCGCTACCAGAAGGCAGCCAAGGGCG
-L--N--G--T--E--L--E--G--S--C--L--E--V--T--L--A--K--P--V--D--K--E--Q--Y--S--R--Y--Q--K--A--A--K--G--

----------------------------------------------------------------------------------------------------
G--G--A--A--E--A--A--------Q--Q--P--S--Y--V--Y--S--C--D--P--Y--T--L--A--Y--Y--G--Y--P--Y--N--A--L--I
GCGGCGCGGCTGAGGCAGCG------CAGCAGCCCAGCTACGTGTACTCCTGCGACCCCTACACACTGGCCTACTACGGCTACCCCTACAACGCGCTCAT
:::::::.::.:::::.:::      ::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::.::
GCGGCGCAGCCGAGGCGGCGGTAGTGCAGCAGCCCAGCTACGTGTACTCCTGCGACCCCTACACGCTGGCCTACTACGGCTACCCCTACAACGCGCTTAT
G--G--A--A--E--A--A--V--V--Q--Q--P--S--Y--V--Y--S--C--D--P--Y--T--L--A--Y--Y--G--Y--P--Y--N--A--L--I

----------------------------><----------------------------------------------------------------------
--G--P--N--R--D--Y--F--V--K--A--G--S--I--R--G--R--G--R--G--A--A--G--N--R--A--P--G--P--R--G--S--Y--L-
TGGGCCCAACAGGGACTACTTTGTGAAAGCAGGCAGCATAAGAGGCCGAGGGCGAGGTGCAGCTGGCAACAGAGCCCCAGGGCCTAGGGGTTCCTACCTC
.::::::::::::::::::::.::::::   :::::::::::::::::.:: ::::::::::::::::::::::::::::::::.::::::::::::::.
CGGGCCCAACAGGGACTACTTCGTGAAA---GGCAGCATAAGAGGCCGGGGTCGAGGTGCAGCTGGCAACAGAGCCCCAGGGCCCAGGGGTTCCTACCTT
--G--P--N--R--D--Y--F--V--K-----G--S--I--R--G--R--G--R--G--A--A--G--N--R--A--P--G--P--R--G--S--Y--L-

----------------------------------------------------------------------------------------------------
-G--G--Y--S--A--G--R--G--I--Y--S--R--Y--H--E--G--K--G--K--Q--Q--E--K--G--Y--E--L--V--P--N--L--E--I--
GGGGGATATTCTGCTGGTCGTGGTATATATAGCCGATATCATGAAGGGAAAGGAAAGCAGCAAGAAAAAGGATATGAACTGGTGCCGAATTTGGAAATCC
:::::::::::::::::.:::::::::::::::::.:::::::::::.::::::::.::.:::::::::::::::::::: ::.:: ::::::::::::.
GGGGGATATTCTGCTGGCCGTGGTATATATAGCCGGTATCATGAAGGAAAAGGAAAACAACAAGAAAAAGGATATGAACTTGTACCTAATTTGGAAATCT
-G--G--Y--S--A--G--R--G--I--Y--S--R--Y--H--E--G--K--G--K--Q--Q--E--K--G--Y--E--L--V--P--N--L--E--I--

-----------------------------------><---------------------------------------------------------------
P--T--V--N--P--V--A--I--K--P--G--T--V--A--I--P--A--I--G--A--Q--Y--S--M--F--P--A--A--P--A--P--K--M--I
CTACCGTCAACCCAGTTGCCATTAAACCTGGTACAGTAGCCATCCCTGCCATTGGGGCTCAGTATTCCATGTTTCCAGCAGCTCCAGCCCCTAAAATGAT
: .:::::::.::::::::::::::::::::::::   ::::::::::::::::: ::.:::::.::::::::.: .:::::.::.:::::::::::.::
CGGCCGTCAATCCAGTTGCCATTAAACCTGGTACA---GCCATCCCTGCCATTGGTGCCCAGTACTCCATGTTCCAGGCAGCCCCGGCCCCTAAAATAAT
S--A--V--N--P--V--A--I--K--P--G--T-----A--I--P--A--I--G--A--Q--Y--S--M--F--Q--A--A--P--A--P--K--I--I

----------------------------------------------------------------------------------------------------
--E--D--G--K--I--H--T--V--E--H--M--I--S--P--I--A--V--Q--P--D--P--A--S--A--A--A--A--A--A--A--A--A--A-
TGAAGATGGCAAAATCCACACAGTGGAGCACATGATCAGCCCCATTGCTGTGCAGCCAGACCCAGCCAGTGCTGCTGCCGCCGCAGCCGCGGCCGCAGCC
::::::::::::.:::::::::.::::.:::::::::::::::::::: ::::::::::::::.:::: :      ::.::.:: ::::: ::.:: ::.
TGAAGATGGCAAGATCCACACAATGGAACACATGATCAGCCCCATTGCGGTGCAGCCAGACCCGGCCACT------GCTGCTGCCGCCGCCGCTGCCGCT
--E--D--G--K--I--H--T--M--E--H--M--I--S--P--I--A--V--Q--P--D--P--A--T--------A--A--A--A--A--A--A--A-

-----------------------------------------------><---------------------------------------------------
-A--A--A--A--V--I--P--T--V--S--T--P--P--P--F--Q--G--R--P--I--T--P--V--Y--T--V--A--P--N--V--Q--R--I--
GCCGCAGCCGCTGTCATTCCCACTGTGTCGACGCCACCACCTTTCCAGGGCCGCCCAATAACTCCAGTATACACGGTGGCTCCAAACGTTCAGAGAATTC
::.:: ::.:::::::::::..: ::.:: ::.::.::.::::::::::::::.::::::::::: ::.::::: ::::: :::::.:::: ::::::.:
GCTGCTGCTGCTGTCATTCCTGCGGTATCCACACCGCCGCCTTTCCAGGGCCGTCCAATAACTCCTGTGTACACTGTGGCACCAAATGTTCCGAGAATCC
-A--A--A--A--V--I--P--A--V--S--T--P--P--P--F--Q--G--R--P--I--T--P--V--Y--T--V--A--P--N--V--P--R--I--

----------------------------------------------------------------------------------><----------------
P--T--A--G--I--Y--G--A--S--Y--V--P--F--A--A--P--A--T--A--T--I--A--T--L--Q--K--N--A--P--R--P--P--C--M
CTACTGCCGGGATCTACGGGGCCAGTTACGTGCCATTTGCTGCTCCAGCTACAGCCACGATCGCCACACTACAGAAGAACGCGCCGCGGCCGCCATGTAT
:.::.::::: ::::::::::::::.::::: :: :::::::::::.::.:: :::::.::::::::::::::::::::::::::.::::::::.: ::.
CCACCGCCGGCATCTACGGGGCCAGCTACGTCCCCTTTGCTGCTCCGGCCACTGCCACAATCGCCACACTACAGAAGAACGCGCCACGGCCGCCGTCTAC
P--T--A--G--I--Y--G--A--S--Y--V--P--F--A--A--P--A--T--A--T--I--A--T--L--Q--K--N--A--P--R--P--P--S--T

------------------------------><------------------------------------------------->
--E--D--T--Q--A--T--Y--L--R--P--P--A--A--A--I--Q--V--P--I--P--D--V--Y--Q--T--Y--*-
GGAGGATACGCAGGCTACATACCTCAGGCCTCCTGCTGCTGCCATTCAGGTCCCCATCCCCGACGTCTACCAGACATACTGA
:: :::::::::::::::::::::::::::::::::.::.:::::.::::::::::::: ::::::::::::::: ::::::
GGCGGATACGCAGGCTACATACCTCAGGCCTCCTGCCGCCGCCATCCAGGTCCCCATCCACGACGTCTACCAGACCTACTGA
--A--D--T--Q--A--T--Y--L--R--P--P--A--A--A--I--Q--V--P--I--H--D--V--Y--Q--T--Y--*-

Pig Consensus Sequence

>BGISUST0000888767
ATGACCGCAGAGGATTCCACCGCAGCCATGAGCAGCGACTCCGCCGCCGGATCCTCGGCCAAGGTGCCCGAGGGCGTGGCGGGCGCGCCCAACGAGGCTG
CGCTGCTGGCGCTGATGGAGCGCACTGGTTACAGCATGGTGCAGGAGAACGGGCAGCGCAAGTACGGAGGCCCTCCGCCCGGCTGGGACGGCCCGCACCC
GCAGCGCGGCTGCGAGGTCTTCGTGGGCAAGATCCCGCGCGACGTGTACGAGGACGAGCTGGTGCCGGTGTTCGAGACGGTGGGTCGCATCTACGAGCTC
CGCCTCATGATGGACTTCGATGGCAAGAACCGCGGCTACGCCTTCGTCATGTACTGCCACAAGAACGAGGCCAAGCGCGCCGTGCGCGAGCTCAACAACT
ACGAGATCCGGCCCGGCCGCCTGCTGGGCGTGTGCTGCAGCGTTGACAACTGCCGCCTCTTCATCGGTGGCATCCCCAAGATGAAGAAGCGCGAGGAGAT
CCTGGAAGAGATCGCCAAGGTCACGGAGGGCGTGCTCGACGTGATCGTCTACGCCAGCGCGGCCGACAAGATGAAGAACCGCGGCTTCGCCTTCGTGGAG
TACGAGAGCCACCGCGCCGCTGCGATGGCGCGCCGCAAGCTCATGCCCGGCCGCATCCAGCTGTGGGGCCACCAGATCGCCGTGGACTGGGCCGAGCCCG
AGATAGACGTGGACGAGGACGTGATGGAGACCGTGAAGATCCTCTACGTGCGGAACCTCATGATCGAGACCACCGAGGACACCATCAAGAAGAGCTTCGG
CCAGTTCAATCCCGGCTGCGTGGAGCGCGTCAAGAAGATCCGCGACTACGCCTTCGTGCACTTTGCCAGCCGCGAGGACGCCGTGCACGCCATGAACAAC
CTCAACGGCACTGAGCTGGAGGGCTCGTGCCTCGAGGTGACGCTGGCTAAGCCGGTGGACAAGGAGCAGTACTCCCGCTACCAGAAGGCAGCCAAGGGCG
GCGGCGCAGCCGAGGCGGCGGTAGTGCAGCAGCCCAGCTACGTGTACTCCTGCGACCCCTACACGCTGGCCTACTACGGCTACCCCTACAACGCGCTTAT
CGGGCCCAACAGGGACTACTTC---GGCAGCATAAGAGGCCGGGGTCGAGGTGCAGCTGGCAACAGAGCCCCAGGGCCCAGGGGTTCCTACCTTGGGGGA
TATTCTGCTGGCCGTGGTATATATAGCCGGTATCATGAAGGAAAAGGAAAACAACAAGAAAAAGGATATGAACTTGTACCTAATTTGGAAATCTCGGCCG
TCAATCCAGTTGCCATTAAACCTGGTACA---GCCATCCCTGCCATTGGTGCCCAGTACTCCATGTTCCAGGCAGCCCCGGCCCCTAAAATAATTGAAGA
TGGCAAGATCCACACAATGGAACACATGATCAGCCCCATTGCGGTGCAGCCAGACCCGGCCACTGCTGCTGCCGCCGCCGCTGCCGCTGCTGCTGCTGCT
GTCATTCCTGCGGTATCCACACCGCCGCCTTTCCAGGGCCGTCCAATAACTCCTGTGTACACTGTGGCACCAAATGTTCCGAGAATCCCCACCGCCGGCA
TCTACGGGGCCAGCTACGTCCCCTTTGCTGCTCCGGCCACTGCCACAATCGCCACACTACAGAAGAACGCGCCACGGCCGCCGTCTACGGCGGATACGCA
GGCTACATACCTCAGGCCTCCTGCCGCCGCCATCCAGGTCCCCATCCACGACGTCTACCAGACCTACTGA


>BGISUSP0000888767
MTAEDSTAAMSSDSAAGSSAKVPEGVAGAPNEAALLALMERTGYSMVQENGQRKYGGPPPGWDGPHPQRGCEVFVGKIPRDVYEDELVPVFETVGRIYEL
RLMMDFDGKNRGYAFVMYCHKNEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEIAKVTEGVLDVIVYASAADKMKNRGFAFVE
YESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDEDVMETVKILYVRNLMIETTEDTIKKSFGQFNPGCVERVKKIRDYAFVHFASREDAVHAMNN
LNGTELEGSCLEVTLAKPVDKEQYSRYQKAAKGGGAAEAAVVQQPSYVYSCDPYTLAYYGYPYNALIGPNRDYF-GSIRGRGRGAAGNRAPGPRGSYLGG
YSAGRGIYSRYHEGKGKQQEKGYELVPNLEISAVNPVAIKPGT-AIPAIGAQYSMFQAAPAPKIIEDGKIHTMEHMISPIAVQPDPATAAAAAAAAAAAA
VIPAVSTPPPFQGRPITPVYTVAPNVPRIPTAGIYGASYVPFAAPATATIATLQKNAPRPPSTADTQATYLRPPAAAIQVPIHDVYQTY*