Sequences
EST Library Info
ebs2Foetus 50 days, brain stem
eep3Foetus 50 days, epidermis
eye1Foetus 50 days, Eye
Clusters
Oligos
SNPs

Gene ID ENSG00000163697 (click for geneview)
Transcript ID ENST00000295974(link to ensembl)
Symbol APBB2
Localtion Chromosome:4:40657167:41057416:-1 band: 4p14
Description Amyloid beta A4 precursor protein-binding family B member 2 (Fe65-like protein). [Source:Uniprot/SWISSPROT;Acc:Q92870]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--S--S--G--T--T--D--V--T--N--R-----N--S--P--A--T--P--P--N--T--L--N--L--R--S--S--H--N--E--L--L--
ATGGCCAGCAGCGGAACTACAGACGTCACAAATCGG---AACAGCCCAGCCACACCACCAAACACCCTTAACCTCCGATCCTCCCACAATGAACTGTTGA
:::::::::::::::::.:::::::::::.::::::   :.:::.::::::::::::::::::::::::::.::::: ::::::::::::::::::::::
ATGGCCAGCAGCGGAACCACAGACGTCACGAATCGGA--AGCAGTCCAGCCACACCACCAAACACCCTTAATCTCCGTTCCTCCCACAATGAACTGTTGA
-M--A--S--S--G--T--T--D--V--T--N--R--\--N--S--P--A--T--P--P--N--T--L--N--L--R--S--S--H--N--E--L--L--

----------------------------------------------------------------------------------------------------
N--A--E--I--K--H--T--E--T--K--N--S--T--P--P--K--C--R--K--K--Y--A--L--T--N--I--Q--A--A--M--G--L--S--D
ACGCTGAAATAAAACACACAGAAACCAAGAACAGCACACCTCCCAAATGCAGGAAAAAATATGCACTAACTAACATCCAGGCGGCCATGGGCCTCTCGGA
:::::::::: :::::::: ::::::::::::::::::::.:::::.::::::::::::::::::.::::::::::::::::::: ::::::::::::::
ACGCTGAAATCAAACACACCGAAACCAAGAACAGCACACCCCCCAAGTGCAGGAAAAAATATGCATTAACTAACATCCAGGCGGCAATGGGCCTCTCGGA
N--A--E--I--K--H--T--E--T--K--N--S--T--P--P--K--C--R--K--K--Y--A--L--T--N--I--Q--A--A--M--G--L--S--D

----------------------------------------------------------------------------------------------------
--P--A--A--Q--P--L--L--G--N--G--S--A--N--I--K--L--V--K--N--G--E--N--Q--L--R--K--A--A--E--Q--G--Q--Q-
TCCAGCTGCACAGCCCCTGCTGGGAAATGGCTCTGCCAACATCAAGCTGGTGAAAAATGGGGAGAACCAGCTCCGTAAGGCTGCAGAGCAAGGGCAGCAG
:::.::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::: :::::::: :::::::::::::::
TCCGGCTGCACAGCCCCTGCTGGGAAATGGCTCTGCCAACATCAAGCTGGTGAAGAATGGGGAGAACCAGCTCCGGAAGGCTGCCGAGCAAGGGCAGCAG
--P--A--A--Q--P--L--L--G--N--G--S--A--N--I--K--L--V--K--N--G--E--N--Q--L--R--K--A--A--E--Q--G--Q--Q-

----------------------------------------------------------------------------------------------------
-D--P--N--K--N--L--S--P--T--A--V--I--N--I--T--S--E--K--L--E--G--K--E--P--H--P--Q--D--S--S--S--C--E--
GACCCCAACAAAAACCTGAGCCCCACTGCAGTCATCAACATAACTTCTGAGAAGTTAGAGGGTAAAGAGCCCCACCCACAGGATTCCTCGAGCTGTGAGA
::::::::::::::: : ::::::::::::::::::::::::::::::::::::::.::::::::.::::::::: ::::::: :::::..:::::::::
GACCCCAACAAAAACGTCAGCCCCACTGCAGTCATCAACATAACTTCTGAGAAGTTGGAGGGTAAGGAGCCCCACGCACAGGAGTCCTCAGGCTGTGAGA
-D--P--N--K--N--V--S--P--T--A--V--I--N--I--T--S--E--K--L--E--G--K--E--P--H--A--Q--E--S--S--G--C--E--

----------------------------------------------------------------------------------------------------
I--L--P--S--Q--P--R--R--T--K--S--F--L--N--Y--Y--A--D--L--E--T--S--A--R--E--L--E--Q--N--R--G--N--H--H
TTTTACCCTCCCAGCCCAGGAGAACTAAGAGCTTCCTAAATTACTATGCAGATCTGGAAACCTCAGCCAGAGAACTAGAGCAGAACCGAGGCAATCACCA
::::::::::::::::: :::::::.:::::::::::.::::::::::::::.:::::::::::::::::.:: :: ::::::: :. .:::::.:: ::
TTTTACCCTCCCAGCCCCGGAGAACCAAGAGCTTCCTGAATTACTATGCAGACCTGGAAACCTCAGCCAGGGACCTCGAGCAGACCTCGGGCAACCAGCA
I--L--P--S--Q--P--R--R--T--K--S--F--L--N--Y--Y--A--D--L--E--T--S--A--R--D--L--E--Q--T--S--G--N--Q--H

----------------------------------------------------------------------------------------------------
--G--T--A--E--E--K--S--Q--P--V--Q--G--Q--A--S--T--I--I--G--N--G--D--L--L--L--Q--K--P--N--R--P--Q--S-
TGGGACTGCGGAAGAGAAATCCCAGCCAGTCCAGGGCCAGGCCTCCACCATCATTGGGAATGGCGATTTGCTGCTGCAGAAACCAAACAGACCCCAGTCC
.:::.:.:.::::::::: :::::::::: :::::::::::::::::::.:: :::::::::::: :::::::::::::::::::::::..:::::::.:
CGGGGCCGTGGAAGAGAATTCCCAGCCAGGCCAGGGCCAGGCCTCCACCGTCCTTGGGAATGGCGCTTTGCTGCTGCAGAAACCAAACAAGCCCCAGTTC
--G--A--V--E--E--N--S--Q--P--G--Q--G--Q--A--S--T--V--L--G--N--G--A--L--L--L--Q--K--P--N--K--P--Q--F-

----------------------------------------------------------------------------------------------------
-S--P--E--D--G--Q--V--A--T--V--S--S--S--P--E--T--K--K--D--H--P--K--T--G--A--K--T--D--C--A--L--H--R--
AGCCCTGAAGACGGCCAAGTAGCCACAGTGTCATCCAGCCCAGAAACCAAGAAGGATCATCCGAAAACAGGGGCCAAAACCGACTGTGCACTGCACCGGA
:::::.::.::.:::::  :::::::.::::: ::::::::.::.::::::::::::::.:::::.::.::::::::::::::.::.::.::::::::::
AGCCCCGAGGATGGCCACCTAGCCACGGTGTCCTCCAGCCCGGAGACCAAGAAGGATCACCCGAAGACGGGGGCCAAAACCGATTGCGCGCTGCACCGGA
-S--P--E--D--G--H--L--A--T--V--S--S--S--P--E--T--K--K--D--H--P--K--T--G--A--K--T--D--C--A--L--H--R--

--------------------------------------------------------------------------------------><------------
I--Q--N--L--A--P--S--D--E--E--S--S--W--T--T--L--S--Q--D--S--A--S--P--S--S--P--D--E--T--D--I--W--S--D
TCCAGAACCTGGCACCGAGCGATGAGGAGTCCAGCTGGACAACGTTGTCCCAAGACAGTGCCTCACCCAGCTCCCCGGATGAAACAGATATATGGAGTGA
:::::::::::::.:::::.::.:::::::::::::::::.::..:.:::::::::::.::::: :::::::::::::::::.:::   .:::::::.::
TCCAGAACCTGGCGCCGAGTGACGAGGAGTCCAGCTGGACGACACTATCCCAAGACAGCGCCTCCCCCAGCTCCCCGGATGAGACA---GTATGGAGCGA
I--Q--N--L--A--P--S--D--E--E--S--S--W--T--T--L--S--Q--D--S--A--S--P--S--S--P--D--E--T-----V--W--S--D

----------------------------------------------------------------------------------------------------
--H--S--F--Q--T--D--P--D--L--P--P--G--W--K--R--V--S--D--I--A--G--T--Y--Y--W--H--I--P--T--G--T--T--Q-
TCACTCATTTCAGACTGATCCAGATTTGCCGCCTGGCTGGAAAAGAGTCAGTGACATTGCCGGGACCTATTATTGGCACATCCCAACAGGAACGACTCAG
:::::: ::::::::.::::::::::::::::: ::::::::.:::.:::.::::::.::.::::::::.::::::::::: :: :::::.:::::::::
TCACTCCTTTCAGACCGATCCAGATTTGCCGCCGGGCTGGAAGAGAATCAATGACATCGCTGGGACCTACTATTGGCACATACCCACAGGGACGACTCAG
--H--S--F--Q--T--D--P--D--L--P--P--G--W--K--R--I--N--D--I--A--G--T--Y--Y--W--H--I--P--T--G--T--T--Q-

--------------------------------------------------------------------------------------------><------
-W--E--R--P--V--S--I--P--A--D--L--Q--G--S--R--K--G--S--L--S--S--V--T--P--S--P--T--P--E--N--E--K--Q--
TGGGAACGGCCCGTCTCCATCCCAGCAGATCTCCAGGGTTCTAGGAAAGGGTCACTTAGTTCTGTAACGCCATCTCCCACCCCAGAGAACGAGAAACAGC
:::::::: ::.::::::::::::::::::                                                               :::::::
TGGGAACGCCCTGTCTCCATCCCAGCAGAT---------------------------------------------------------------AAACAGC
-W--E--R--P--V--S--I--P--A--D-----------------------------------------------------------------K--Q--

-------------------------------------------------------><-------------------------------------------
P--W--S--D--F--A--V--L--N--G--G--K--I--N--S--D--I--W--K--D--L--H--A--A--T--V--N--P--D--P--S--L--K--E
CATGGAGTGATTTTGCTGTTCTGAATGGGGGAAAGATTAATAGTGACATTTGGAAGGATTTGCATGCAGCCACTGTTAACCCGGACCCCAGTTTAAAAGA
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::.::::::::::::::::::::.::
CATGGAGTGATTTTGCTGTTCTGAATGGGGGAAAGATTAATAGTGACATTTGGAAGGATTTGCATGCAGCCACAGTCAACCCGGACCCCAGTTTAAAGGA
P--W--S--D--F--A--V--L--N--G--G--K--I--N--S--D--I--W--K--D--L--H--A--A--T--V--N--P--D--P--S--L--K--E

-----------------------------------------><---------------------------------------------------------
--F--E--G--A--T--L--R--Y--A--S--L--K--L--R--N--A--P--H--P--D--D--D--D--S--C--S--I--N--S--D--P--E--A-
GTTTGAAGGAGCAACCCTACGCTATGCATCTTTGAAACTCAGAAATGCCCCACACCCTGATGATGATGATTCTTGTAGTATCAACAGTGACCCAGAAGCC
.::::::::::: :: ::.:::::.:::::.:::::::::   :::::::::::. ::::::::::::::::::::::.:::::::::::::::::::::
ATTTGAAGGAGCCACACTGCGCTACGCATCCTTGAAACTC---AATGCCCCACATGCTGATGATGATGATTCTTGTAGCATCAACAGTGACCCAGAAGCC
--F--E--G--A--T--L--R--Y--A--S--L--K--L-----N--A--P--H--A--D--D--D--D--S--C--S--I--N--S--D--P--E--A-

--><------------------------------------------------------------------------------------------------
-K--C--F--A--V--R--S--L--G--W--V--E--M--A--E--E--D--L--A--P--G--K--S--S--V--A--V--N--N--C--I--R--Q--
AAGTGTTTTGCTGTGCGTTCTCTGGGATGGGTAGAGATGGCAGAAGAGGACCTCGCCCCCGGTAAAAGTAGTGTTGCGGTCAACAACTGCATCAGGCAAC
:::                                                                                                 
AAG-------------------------------------------------------------------------------------------------
-K--------------------------------------------------------------------------------------------------

-------------------------------------------------><-------------------------------------------------
L--S--Y--C--K--N--D--I--R--D--T--V--G--I--W--G--E--G--K--D--M--Y--L--I--L--E--N--D--M--L--S--L--V--D
TTTCCTACTGCAAAAATGACATCCGAGACACAGTCGGGATTTGGGGAGAGGGGAAAGACATGTACCTGATCCTGGAGAATGACATGCTCAGCCTGGTGGA
                                                  :::::.::::::::::::.::::::::::.::::.:::::::::::::::
--------------------------------------------------GGGAAGGACATGTACCTGGTCCTGGAGAACGACACGCTCAGCCTGGTGGA
---------------------------------------------------G--K--D--M--Y--L--V--L--E--N--D--T--L--S--L--V--D

-----------------------------------------------------------------------------><---------------------
--P--M--D--R--S--V--L--H--S--Q--P--I--V--S--I--R--V--W--G--V--G--R--D--N--G--R--D--F--A--Y--V--A--R-
CCCCATGGACCGCAGCGTGCTGCACTCGCAGCCCATCGTCAGCATCCGCGTGTGGGGCGTGGGCCGCGACAATGGCCGGGATTTTGCTTATGTAGCAAGA
:::::::::::.::::::::: ::. ::::::::::::::::::::::::::::::::::::::::::::::.:::                        
CCCCATGGACCACAGCGTGCTCCATGCGCAGCCCATCGTCAGCATCCGCGTGTGGGGCGTGGGCCGCGACAACGGC------------------------
--P--M--D--H--S--V--L--H--A--Q--P--I--V--S--I--R--V--W--G--V--G--R--D--N--G-------------------------

--------------------------------------------------------------------------------------------><------
-D--K--D--T--R--I--L--K--C--H--V--F--R--C--D--T--P--A--K--A--I--A--T--S--L--H--E--I--C--S--K--I--M--
GATAAAGATACAAGAATTTTGAAATGTCATGTATTTCGATGTGACACACCAGCAAAAGCCATTGCCACAAGTCTCCACGAGATCTGCTCCAAGATTATGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------><------------------
A--E--R--K--N--A--K--A--L--A--C--S--S--L--Q--E--R--A--N--V--N--L--D--V--P--L--Q--V--D--F--P--T--P--K
CTGAACGGAAGAATGCCAAAGCGCTGGCCTGCAGCTCCTTACAGGAAAGGGCCAATGTGAACCTCGATGTCCCTTTGCAAGTAGATTTTCCAACACCAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------><----------------------------------
--T--E--L--V--Q--K--F--H--V--Q--Y--L--G--M--L--P--V--D--K--P--V--G--M--D--I--L--N--S--A--I--E--N--L-
GACTGAGCTGGTCCAGAAGTTCCACGTGCAGTACTTGGGCATGTTACCTGTAGACAAACCAGTCGGAATGGATATTTTGAACAGTGCCATAGAAAATCTT
                                                                               ::::.:::::::::::.::::
-------------------------------------------------------------------------------AACAATGCCATAGAAAGTCTT
--------------------------------------------------------------------------------N--N--A--I--E--S--L-

--------------------------------------------------------------------------------><------------------
-M--T--S--S--N--K--E--D--W--L--S--V--N--M--N--V--A--D--A--T--V--T--V--I--S--E--K--N--E--E--E--V--L--
ATGACCTCATCCAACAAGGAGGACTGGCTGTCAGTGAACATGAACGTGGCTGATGCCACTGTGACTGTCATCAGTGAAAAGAATGAAGAGGAAGTCTTAG
::::::::.::::.:::.::::::::::.::: :::::::::::.:::::.:::::.::::::::::::::::::::.::::::::::::::::::.:.:
ATGACCTCGTCCAGCAAAGAGGACTGGCCGTCCGTGAACATGAATGTGGCCGATGCTACTGTGACTGTCATCAGTGAGAAGAATGAAGAGGAAGTCCTGG
-M--T--S--S--S--K--E--D--W--P--S--V--N--M--N--V--A--D--A--T--V--T--V--I--S--E--K--N--E--E--E--V--L--

----------------------------------------------------------------------------------------------------
V--E--C--R--V--R--F--L--S--F--M--G--V--G--K--D--V--H--T--F--A--F--I--M--D--T--G--N--Q--R--F--E--C--H
TGGAATGTCGTGTGCGATTCCTGTCCTTCATGGGTGTTGGGAAGGACGTCCACACATTTGCCTTCATCATGGACACGGGGAACCAGCGCTTTGAGTGCCA
::::.::::: :::::::::::::::::::::::.::.::::::::::: :::::.:::::::::::::::::::: ::::::::::.:::.::::::::
TGGAGTGTCGGGTGCGATTCCTGTCCTTCATGGGCGTCGGGAAGGACGTGCACACGTTTGCCTTCATCATGGACACTGGGAACCAGCACTTCGAGTGCCA
V--E--C--R--V--R--F--L--S--F--M--G--V--G--K--D--V--H--T--F--A--F--I--M--D--T--G--N--Q--H--F--E--C--H

------------------------------------------------------------><--------------------------------------
--V--F--W--C--E--P--N--A--G--N--V--S--E--A--V--Q--A--A--C--M--L--R--Y--Q--K--C--L--V--A--R--P--P--S-
CGTTTTCTGGTGCGAGCCTAATGCTGGTAACGTGTCTGAGGCGGTGCAGGCCGCCTGCATGTTACGATATCAGAAGTGCTTGGTAGCCAGGCCGCCTTCT
:::::::::::::::::::::.::.:  :::::::: ::::: ::::::::::::::::::::::::::.::::::::::::::::::::::::::::: 
CGTTTTCTGGTGCGAGCCTAACGCCGCGAACGTGTCAGAGGCCGTGCAGGCCGCCTGCATGTTACGATACCAGAAGTGCTTGGTAGCCAGGCCGCCTTCA
--V--F--W--C--E--P--N--A--A--N--V--S--E--A--V--Q--A--A--C--M--L--R--Y--Q--K--C--L--V--A--R--P--P--S-

----------------------------------------------------------------------------------------------------
-Q--K--V--R--P--P--P--P--P--A--D--S--V--T--R--R--V--T--T--N--V--K--R--G--V--L--S--L--I--D--T--L--K--
CAGAAAGTTCGACCACCTCCACCGCCAGCAGATTCAGTAACCAGAAGAGTCACAACCAATGTAAAACGAGGGGTCTTATCCCTCATTGACACTTTGAAAC
::::::::.::::::::::: :::::::::::.:::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CAGAAAGTCCGACCACCTCCTCCGCCAGCAGACTCAGTGACCAGAAGAGTCACAACCAATGTAAAACGAGGGGTCTTATCCCTCATTGACACTTTGAAAC
-Q--K--V--R--P--P--P--P--P--A--D--S--V--T--R--R--V--T--T--N--V--K--R--G--V--L--S--L--I--D--T--L--K--

---------------------------->
Q--K--R--P--V--T--E--M--P--*-
AGAAACGCCCTGTCACCGAAATGCCATAG
:::::::::: ::::: ::::..::::::
AGAAACGCCCAGTCACAGAAACACCATAG
Q--K--R--P--V--T--E--T--P--*-

Pig Consensus Sequence

>BGISUST0000890630
ATGGCCAGCAGCGGAACCACAGACGTCACGAATCGgaGCAGTCCAGCCACACCACCAAACACCCTTAATCTCCGTTCCTCCCACAATGAACTGTTGAACG
CTGAAATCAAACACACCGAAACCAAGAACAGCACACCCCCCAAGTGCAGGAAAAAATATGCATTAACTAACATCCAGGCGGCAATGGGCCTCTCGGATCC
GGCTGCACAGCCCCTGCTGGGAAATGGCTCTGCCAACATCAAGCTGGTGAAGAATGGGGAGAACCAGCTCCGGAAGGCTGCCGAGCAAGGGCAGCAGGAC
CCCAACAAAAACGTCAGCCCCACTGCAGTCATCAACATAACTTCTGAGAAGTTGGAGGGTAAGGAGCCCCACGCACAGGAGTCCTCAGGCTGTGAGATTT
TACCCTCCCAGCCCCGGAGAACCAAGAGCTTCCTGAATTACTATGCAGACCTGGAAACCTCAGCCAGGGACCTCGAGCAGACCTCGGGCAACCAGCACGG
GGCCGTGGAAGAGAATTCCCAGCCAGGCCAGGGCCAGGCCTCCACCGTCCTTGGGAATGGCGCTTTGCTGCTGCAGAAACCAAACAAGCCCCAGTTCAGC
CCCGAGGATGGCCACCTAGCCACGGTGTCCTCCAGCCCGGAGACCAAGAAGGATCACCCGAAGACGGGGGCCAAAACCGATTGCGCGCTGCACCGGATCC
AGAACCTGGCGCCGAGTGACGAGGAGTCCAGCTGGACGACACTATCCCAAGACAGCGCCTCCCCCAGCTCCCCGGATGAGACA---GTATGGAGCGATCA
CTCCTTTCAGACCGATCCAGATTTGCCGCCGGGCTGGAAGAGAATCAATGACATCGCTGGGACCTACTATTGGCACATACCCACAGGGACGACTCAGTGG
GAACGCCCTGTCTCCATCCCAGCAGAT---------------------------------------------------------------AAACAGCCAT
GGAGTGATTTTGCTGTTCTGAATGGGGGAAAGATTAATAGTGACATTTGGAAGGATTTGCATGCAGCCACAGTCAACCCGGACCCCAGTTTAAAGGAATT
TGAAGGAGCCACACTGCGCTACGCATCCTTGAAACTC---AATGCCCCACATGCTGATGATGATGATTCTTGTAGCATCAACAGTGACCCAGAAGCCAAG
----------------------------------------------------------------------------------------------------
-----------------------------------------------GGGAAGGACATGTACCTGGTCCTGGAGAACGACACGCTCAGCCTGGTGGACCC
CATGGACCACAGCGTGCTCCATGCGCAGCCCATCGTCAGCATCCGCGTGTGGGGCGTGGGCCGCGACAACGGC---------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------AACAATGCCATAGAAAGTCTTATG
ACCTCGTCCAGCAAAGAGGACTGGCCGTCCGTGAACATGAATGTGGCCGATGCTACTGTGACTGTCATCAGTGAGAAGAATGAAGAGGAAGTCCTGGTGG
AGTGTCGGGTGCGATTCCTGTCCTTCATGGGCGTCGGGAAGGACGTGCACACGTTTGCCTTCATCATGGACACTGGGAACCAGCACTTCGAGTGCCACGT
TTTCTGGTGCGAGCCTAACGCCGCGAACGTGTCAGAGGCCGTGCAGGCCGCCTGCATGTTACGATACCAGAAGTGCTTGGTAGCCAGGCCGCCTTCACAG
AAAGTCCGACCACCTCCTCCGCCAGCAGACTCAGTGACCAGAAGAGTCACAACCAATGTAAAACGAGGGGTCTTATCCCTCATTGACACTTTGAAACAGA
AACGCCCAGTCACAGAAACACCATAG


>BGISUSP0000890630
MASSGTTDVTNRSSPATPPNTLNLRSSHNELLNAEIKHTETKNSTPPKCRKKYALTNIQAAMGLSDPAAQPLLGNGSANIKLVKNGENQLRKAAEQGQQD
PNKNVSPTAVINITSEKLEGKEPHAQESSGCEILPSQPRRTKSFLNYYADLETSARDLEQTSGNQHGAVEENSQPGQGQASTVLGNGALLLQKPNKPQFS
PEDGHLATVSSSPETKKDHPKTGAKTDCALHRIQNLAPSDEESSWTTLSQDSASPSSPDET-VWSDHSFQTDPDLPPGWKRINDIAGTYYWHIPTGTTQW
ERPVSIPAD---------------------KQPWSDFAVLNGGKINSDIWKDLHAATVNPDPSLKEFEGATLRYASLKL-NAPHADDDDSCSINSDPEAK
-------------------------------------------------GKDMYLVLENDTLSLVDPMDHSVLHAQPIVSIRVWGVGRDNG---------
--------------------------------------------------------------------------------------------NNAIESLM
TSSSKEDWPSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQHFECHVFWCEPNAANVSEAVQAACMLRYQKCLVARPPSQ
KVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTETP*