Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000144730 (click for geneview)
Transcript ID ENST00000296318(link to ensembl)
Symbol IL17RD
Localtion Chromosome:3:57103318:57174443:-1 band: 3p14.3
Description interleukin 17 receptor D [Source:RefSeq_peptide;Acc:NP_060033]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--P--W--L--Q--L--C--S--V--F--F--T--V--N--A--C--L--N--G--S--Q--L--A--V--A--A--G--G--S--G--R--A--
ATGGCCCCGTGGCTGCAGCTCTGCTCCGTCTTCTTTACGGTCAACGCCTGCCTCAACGGCTCGCAGCTGGCTGTGGCCGCTGGCGGGTCCGGCCGCGCGC
::::::::::::.:::::::::::::.::::::::.:: ::::::::::::::::::::::::::..::::.:::::::: ::.:: :::.:: : :: :
ATGGCCCCGTGGTTGCAGCTCTGCTCTGTCTTCTTCACCGTCAACGCCTGCCTCAACGGCTCGCAATTGGCCGTGGCCGCAGGTGGCTCCAGCAGAGCTC
-M--A--P--W--L--Q--L--C--S--V--F--F--T--V--N--A--C--L--N--G--S--Q--L--A--V--A--A--G--G--S--S--R--A--

-------------------------><--------------------------------------------------------><---------------
R--G--A--D--T--C--G--W--R--G--V--G--P--A--S--R--N--S--G--L--Y--N--I--T--F--K--Y--D--N--C--T--T--Y--L
GGGGCGCCGACACCTGTGGCTGGAGGGGAGTGGGGCCAGCCAGCAGAAACAGTGGGCTGTACAACATCACCTTCAAATATGACAATTGTACCACCTACTT
:::::: :::::::::.::::::::::::::::::::.:::::::::::::::::::::.:::::::::::::::.:::::::   ::.:::::.:::::
GGGGCGGCGACACCTGCGGCTGGAGGGGAGTGGGGCCGGCCAGCAGAAACAGTGGGCTGCACAACATCACCTTCAGATATGAC---TGCACCACTTACTT
R--G--G--D--T--C--G--W--R--G--V--G--P--A--S--R--N--S--G--L--H--N--I--T--F--R--Y--D-----C--T--T--Y--L

----------------------------------------------------------------------------------------------------
--N--P--V--G--K--H--V--I--A--D--A--Q--N--I--T--I--S--Q--Y--A--C--H--D--Q--V--A--V--T--I--L--W--S--P-
GAATCCAGTGGGGAAGCATGTGATTGCTGACGCCCAGAATATCACCATCAGCCAGTATGCTTGCCATGACCAAGTGGCAGTCACCATTCTTTGGTCCCCA
::.::: :::::::::::::::::.::.:::::::::::::::::::::::.:::::.::.:::::.:::::::::::::::::::::::.:::::::::
GAGTCCTGTGGGGAAGCATGTGATCGCCGACGCCCAGAATATCACCATCAGTCAGTACGCCTGCCACGACCAAGTGGCAGTCACCATTCTCTGGTCCCCA
--S--P--V--G--K--H--V--I--A--D--A--Q--N--I--T--I--S--Q--Y--A--C--H--D--Q--V--A--V--T--I--L--W--S--P-

---------><-----------------------------------------------------------------------------------------
-G--A--L--G--I--E--F--L--K--G--F--R--V--I--L--E--E--L--K--S--E--G--R--Q--C--Q--Q--L--I--L--K--D--P--
GGGGCCCTCGGCATCGAATTCCTGAAAGGATTTCGGGTAATACTGGAGGAGCTGAAGTCGGAGGGAAGACAGTGCCAACAACTGATTCTAAAGGATCCGA
:::::::::   :::::::::::.:::::::::::::::::::::::::::::::::::.::.::::::::::::::::::::::::::.:::::.::::
GGGGCCCTC---ATCGAATTCCTAAAAGGATTTCGGGTAATACTGGAGGAGCTGAAGTCAGAAGGAAGACAGTGCCAACAACTGATTCTGAAGGACCCGA
-G--A--L-----I--E--F--L--K--G--F--R--V--I--L--E--E--L--K--S--E--G--R--Q--C--Q--Q--L--I--L--K--D--P--

----------------------------><----------------------------------------------------------------------
K--Q--L--N--S--S--F--K--R--T--G--M--E--S--Q--P--F--L--N--M--K--F--E--T--D--Y--F--V--K--V--V--P--F--P
AGCAGCTCAACAGTAGCTTCAAAAGAACTGGAATGGAATCTCAACCTTTCCTGAATATGAAATTTGAAACGGATTATTTCGTAAAGGTTGTCCCTTTTCC
::::::::::::::::::::::::::   ::::::::::::::.::::::::::::::::::::::::::.:::::.::.:: :::.:::::::::::::
AGCAGCTCAACAGTAGCTTCAAAAGA---GGAATGGAATCTCAGCCTTTCCTGAATATGAAATTTGAAACAGATTACTTTGTCAAGATTGTCCCTTTTCC
K--Q--L--N--S--S--F--K--R-----G--M--E--S--Q--P--F--L--N--M--K--F--E--T--D--Y--F--V--K--I--V--P--F--P

-------------------------------------------------><-------------------------------------------><----
--S--I--K--N--E--S--N--Y--H--P--F--F--F--R--T--R--A--C--D--L--L--L--Q--P--D--N--L--A--C--K--P--F--W-
TTCCATTAAAAACGAAAGCAATTACCACCCTTTCTTCTTTAGAACCCGAGCCTGTGACCTGTTGTTACAGCCGGACAATCTAGCTTGTAAACCCTTCTGG
::::::::::::::::::::::::.:::::::::::::::::::::                                                   :::
TTCCATTAAAAACGAAAGCAATTATCACCCTTTCTTCTTTAGAACC---------------------------------------------------TGG
--S--I--K--N--E--S--N--Y--H--P--F--F--F--R--T-----------------------------------------------------W-

----------------------------------------------------------------------------------------------------
-K--P--R--N--L--N--I--S--Q--H--G--S--D--M--Q--V--S--F--D--H--A--P--H--N--F--G--F--R--F--F--Y--L--H--
AAGCCTCGGAACCTGAACATCAGCCAGCATGGCTCGGACATGCAGGTGTCCTTCGACCATGCACCGCACAACTTCGGCTTCCGTTTCTTCTATCTTCACT
:::::::::::::: ::::::: :::.::::::::.:::::::::::::::::::::::.::.::.::.: ::::::::::::::::::.::::::::::
AAGCCTCGGAACCTCAACATCACCCAACATGGCTCAGACATGCAGGTGTCCTTCGACCACGCGCCACATACCTTCGGCTTCCGTTTCTTTTATCTTCACT
-K--P--R--N--L--N--I--T--Q--H--G--S--D--M--Q--V--S--F--D--H--A--P--H--T--F--G--F--R--F--F--Y--L--H--

----------------------------------------------><----------------------------------------------------
Y--K--L--K--H--E--G--P--F--K--R--K--T--C--K--Q--E--Q--T--T--E--T--T--S--C--L--L--Q--N--V--S--P--G--D
ACAAGCTCAAGCACGAAGGACCTTTCAAGCGAAAGACCTGTAAGCAGGAGCAAACTACAGAGACGACCAGCTGCCTCCTTCAAAATGTTTCTCCAGGGGA
:::::::::::::::::::::..:::::.:::::::::::.::.:::::::::: :::::::::.::::::::::::::::::::::: ::::: :::::
ACAAGCTCAAGCACGAAGGACTCTTCAAACGAAAGACCTGCAAACAGGAGCAAAATACAGAGACAACCAGCTGCCTCCTTCAAAATGTATCTCCTGGGGA
Y--K--L--K--H--E--G--L--F--K--R--K--T--C--K--Q--E--Q--N--T--E--T--T--S--C--L--L--Q--N--V--S--P--G--D

------------><-----------------------------------------------------><-------------------------------
--Y--I--I--E--L--V--D--D--T--N--T--T--R--K--V--M--H--Y--A--L--K--P--V--H--S--P--W--A--G--P--I--R--A-
TTATATAATTGAGCTGGTGGATGACACTAACACAACAAGAAAAGTGATGCATTATGCCTTAAAGCCAGTGCACTCCCCGTGGGCCGGGCCCATCAGAGCC
::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::.:::                                 
TTATATAATTGAGCTGGTGGATGACACTAATACAACAAGAAAAGTGATGCATTATGCCTTAAAACCA---------------------------------
--Y--I--I--E--L--V--D--D--T--N--T--T--R--K--V--M--H--Y--A--L--K--P----------------------------------

------------------------------------------------------------------------------><--------------------
-V--A--I--T--V--P--L--V--V--I--S--A--F--A--T--L--F--T--V--M--C--R--K--K--Q--Q--E--N--I--Y--S--H--L--
GTGGCCATCACAGTGCCACTGGTAGTCATATCGGCATTCGCGACGCTCTTCACTGTGATGTGCCGCAAGAAGCAACAAGAAAATATATATTCACATTTAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--E--E--S--S--E--S--S--T--Y--T--A--A--L--P--R--E--R--L--R--P--R--P--K--V--F--L--C--Y--S--S--K--D--G
ATGAAGAGAGCTCTGAGTCTTCCACATACACTGCAGCACTCCCAAGAGAGAGGCTCCGGCCGCGGCCGAAGGTCTTTCTCTGCTATTCCAGTAAAGATGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------><-----------------------------------
--Q--N--H--M--N--V--V--Q--C--F--A--Y--F--L--Q--D--F--C--G--C--E--V--A--L--D--L--W--E--D--F--S--L--C-
CCAGAATCACATGAATGTCGTCCAGTGTTTCGCCTACTTCCTCCAGGACTTCTGTGGCTGTGAGGTGGCTCTGGACCTGTGGGAAGACTTCAGCCTCTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-R--E--G--Q--R--E--W--V--I--Q--K--I--H--E--S--Q--F--I--I--V--V--C--S--K--G--M--K--Y--F--V--D--K--K--
AGAGAAGGGCAGAGAGAATGGGTCATCCAGAAGATCCACGAGTCCCAGTTCATCATTGTGGTTTGTTCCAAAGGTATGAAGTACTTTGTGGACAAGAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--Y--K--H--K--G--G--G--R--G--S--G--K--G--E--L--F--L--V--A--V--S--A--I--A--E--K--L--R--Q--A--K--Q--S
ACTACAAACACAAAGGAGGTGGCCGAGGCTCGGGGAAAGGAGAGCTCTTCCTGGTGGCGGTGTCAGCCATTGCCGAAAAGCTCCGCCAGGCCAAGCAGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--S--A--A--L--S--K--F--I--A--V--Y--F--D--Y--S--C--E--G--D--V--P--G--I--L--D--L--S--T--K--Y--R--L-
TTCGTCCGCGGCGCTCAGCAAGTTTATCGCCGTCTACTTTGATTATTCCTGCGAGGGAGACGTCCCCGGTATCCTAGACCTGAGTACCAAGTACAGACTC
                                  ::.::.:::::::::::::::::::::::.::::::.::.:.:::::::::::::::::::.::::
----------------------------------TATTTCGATTATTCCTGCGAGGGAGACGTTCCCGGTGTCTTGGACCTGAGTACCAAGTACAAACTC
-----------------------------------Y--F--D--Y--S--C--E--G--D--V--P--G--V--L--D--L--S--T--K--Y--K--L-

----------------------------------------------------------------------------------------------------
-M--D--N--L--P--Q--L--C--S--H--L--H--S--R--D--H--G--L--Q--E--P--G--Q--H--T--R--Q--G--S--R--R--N--Y--
ATGGACAATCTTCCTCAGCTCTGTTCCCACTTGCACTCCCGAGACCACGGCCTCCAGGAGCCGGGGCAGCACACGCGACAGGGCAGCAGAAGGAACTACT
::::::::.::::: ::::::::.::::::.:.:::::.:..:.::.:.: :.:::::::::::::: :: . :: : :. : ::::::.::::::::::
ATGGACAACCTTCCGCAGCTCTGCTCCCACCTACACTCTCAGGGCCGCAGACCCCAGGAGCCGGGGCCGCTTCCGGGCCGCGTCAGCAGGAGGAACTACT
-M--D--N--L--P--Q--L--C--S--H--L--H--S--Q--G--R--R--P--Q--E--P--G--P--L--P--G--R--V--S--R--R--N--Y--

----------------------------------------------------------------------------------------------------
F--R--S--K--S--G--R--S--L--Y--V--A--I--C--N--M--H--Q--F--I--D--E--E--P--D--W--F--E--K--Q--F--V--P--F
TCCGGAGCAAGTCAGGCCGGTCCCTATACGTCGCCATTTGCAACATGCACCAGTTTATTGACGAGGAGCCCGACTGGTTCGAAAAGCAGTTCGTTCCCTT
::::::::::.::.::::: :::::.::.:: :::::::::::::::::::::::::: ::::::::::::::::::::.::.:::::::::::.:::::
TCCGGAGCAAATCGGGCCGCTCCCTGTATGTGGCCATTTGCAACATGCACCAGTTTATAGACGAGGAGCCCGACTGGTTTGAGAAGCAGTTCGTCCCCTT
F--R--S--K--S--G--R--S--L--Y--V--A--I--C--N--M--H--Q--F--I--D--E--E--P--D--W--F--E--K--Q--F--V--P--F

----------------------------------------------------------------------------------------------------
--H--P--P--P--L--R--Y--R--E--P--V--L--E--K--F--D--S--G--L--V--L--N--D--V--M--C--K--P--G--P--E--S--D-
CCATCCTCCTCCACTGCGCTACCGGGAGCCAGTCTTGGAGAAATTTGATTCGGGCTTGGTTTTAAATGATGTCATGTGCAAACCAGGGCCTGAGAGTGAC
::::::: :.:::::.:::.::::::::::::::.:::::::.:::::.::::::::::::::.::.::.::::.  :::..::::::::.:::::.:::
CCATCCTACCCCACTACGCCACCGGGAGCCAGTCCTGGAGAAGTTTGACTCGGGCTTGGTTTTGAACGACGTCACTGGCAGGCCAGGGCCCGAGAGCGAC
--H--P--T--P--L--R--H--R--E--P--V--L--E--K--F--D--S--G--L--V--L--N--D--V--T--G--R--P--G--P--E--S--D-

----------------------------------------------------------------------------------------------------
-F--C--L--K--V--E--A--A--V--L--G--A--T--G--P--A--D--S--Q--H--E--S--Q--H--G--G--L--D--Q--D--G--E--A--
TTCTGCCTAAAGGTAGAGGCGGCTGTTCTTGGGGCAACCGGACCAGCCGACTCCCAGCACGAGAGTCAGCATGGGGGCCTGGACCAAGACGGGGAGGCCC
::: : :: ::::. :::::                                                                                
TTCGGGCTCAAGGCTGAGGCC-------------------------------------------------------------------------------
-F--G--L--K--A--E--A--------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--P--A--L--D--G--S--A--A--L--Q--P--L--L--H--T--V--K--A--G--S--P--S--D--M--P--R--D--S--G--I--Y--D--S
GGCCTGCCCTTGACGGTAGCGCCGCCCTGCAACCCCTGCTGCACACGGTGAAAGCCGGCAGCCCCTCGGACATGCCGCGGGACTCAGGCATCTATGACTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--V--P--S--S--E--L--S--L--P--L--M--E--G--L--S--T--D--Q--T--E--T--S--S--L--T--E--S--V--S--S--S--S-
GTCTGTGCCCTCATCCGAGCTGTCTCTGCCACTGATGGAAGGACTCTCGACGGACCAGACAGAAACGTCTTCCCTGACGGAGAGCGTGTCCTCCTCTTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------><--------------------------------------------------------------------------------------------
-G--L--G--E--E--E--P--P--A--L--P--S--K--L--L--S--S--G--S--C--K--A--D--L--G--C--R--S--Y--T--D--E--L--
GGCCTGGGTGAGGAGGAACCTCCTGCCCTTCCTTCCAAGCTCCTCTCTTCTGGGTCATGCAAAGCAGATCTTGGTTGCCGCAGCTACACTGATGAACTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------->
H--A--V--A--P--L--*-
ACGCGGTCGCCCCTTTGTAA
                    
--------------------
--------------------

Pig Consensus Sequence

>BGISUST0000894480
ATGGCCCCGTGGTTGCAGCTCTGCTCTGTCTTCTTCACCGTCAACGCCTGCCTCAACGGCTCGCAATTGGCCGTGGCCGCAGGTGGCTCCAGCAGAGCTC
GGGGCGGCGACACCTGCGGCTGGAGGGGAGTGGGGCCGGCCAGCAGAAACAGTGGGCTGCACAACATCACCTTCAGATATGAC---TGCACCACTTACTT
GAGTCCTGTGGGGAAGCATGTGATCGCCGACGCCCAGAATATCACCATCAGTCAGTACGCCTGCCACGACCAAGTGGCAGTCACCATTCTCTGGTCCCCA
GGGGCCCTC---ATCGAATTCCTAAAAGGATTTCGGGTAATACTGGAGGAGCTGAAGTCAGAAGGAAGACAGTGCCAACAACTGATTCTGAAGGACCCGA
AGCAGCTCAACAGTAGCTTCAAAAGA---GGAATGGAATCTCAGCCTTTCCTGAATATGAAATTTGAAACAGATTACTTTGTCAAGATTGTCCCTTTTCC
TTCCATTAAAAACGAAAGCAATTATCACCCTTTCTTCTTTAGAACC---------------------------------------------------TGG
AAGCCTCGGAACCTCAACATCACCCAACATGGCTCAGACATGCAGGTGTCCTTCGACCACGCGCCACATACCTTCGGCTTCCGTTTCTTTTATCTTCACT
ACAAGCTCAAGCACGAAGGACTCTTCAAACGAAAGACCTGCAAACAGGAGCAAAATACAGAGACAACCAGCTGCCTCCTTCAAAATGTATCTCCTGGGGA
TTATATAATTGAGCTGGTGGATGACACTAATACAACAAGAAAAGTGATGCATTATGCCTTAAAACCA---------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------TATTTCGATTATTCCTGCGAGGGAGACGTTCCCGGTGTCTTGGACCTGAGTACCAAGTACAAACTC
ATGGACAACCTTCCGCAGCTCTGCTCCCACCTACACTCTCAGGGCCGCAGACCCCAGGAGCCGGGGCCGCTTCCGGGCCGCGTCAGCAGGAGGAACTACT
TCCGGAGCAAATCGGGCCGCTCCCTGTATGTGGCCATTTGCAACATGCACCAGTTTATAGACGAGGAGCCCGACTGGTTTGAGAAGCAGTTCGTCCCCTT
CCATCCTACCCCACTACGCCACCGGGAGCCAGTCCTGGAGAAGTTTGACTCGGGCTTGGTTTTGAACGACGTCACTGGCAGGCCAGGGCCCGAGAGCGAC
TTCGGGCTCAAGGCTGAGGCC-------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------


>BGISUSP0000894480
MAPWLQLCSVFFTVNACLNGSQLAVAAGGSSRARGGDTCGWRGVGPASRNSGLHNITFRYD-CTTYLSPVGKHVIADAQNITISQYACHDQVAVTILWSP
GAL-IEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSFKR-GMESQPFLNMKFETDYFVKIVPFPSIKNESNYHPFFFRT-----------------W
KPRNLNITQHGSDMQVSFDHAPHTFGFRFFYLHYKLKHEGLFKRKTCKQEQNTETTSCLLQNVSPGDYIIELVDDTNTTRKVMHYALKP-----------
----------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------YFDYSCEGDVPGVLDLSTKYKL
MDNLPQLCSHLHSQGRRPQEPGPLPGRVSRRNYFRSKSGRSLYVAICNMHQFIDEEPDWFEKQFVPFHPTPLRHREPVLEKFDSGLVLNDVTGRPGPESD
FGLKAEA---------------------------------------------------------------------------------------------
----------------------------------------