Sequences
BP438020est
BP463914est
rlnt29c_e12.y1est
BP163019est
reje36b_e5.y1est
BP165790est
rese31c_o7.y1est
CJ014330est
DV899250est
reep16c_k21.y1est
rova024_m4.y1est
BP165520est
rthg22_p8.y1est
BW983667est
AJ659994est
rmed29c_k9.y1est
rbyc_13975.y1reads
rski0110_n3.y1est
rnco1922b_a4.y1est
relu1330c_b9.y1est
rspl33_m12.y1est
rcsk15_o17.y1est
BI304408est
CJ009103est
BQ604382est
recc2808c_e13.y1est
rspl26_k9.y1est
rmed32c_d22.y1est
rche01_d14.y1est
rcbl0_021877.y1est
BP141416est
rnco1913b_a10.y1est
CB285480est
BP166924est
rnco1910b_k16.y1est
rthg30_b11.y1est
CB337981est
BW966921est
BI304898est
BP168344est
AJ667210est
rtes16_d19.y1est
BW978273est
AJ664223est
rlin35_i15.y1est
bdb_74925.z1reads
rsin35_a20.y1est
rspl31_e18.y1est
AJ661877est
CB287565est
reje31b_i21.y1est
CB479627est
BW970721est
rcbl0_015944.y1est
rcje37_o20.y1est
rspl22_k9.y1est
rthg16_f7.y1est
DV229028est
rmgp026_d19.y1est
recc2833c_f10.y1est
rnbm26b_i23.y1est
rmed05c_o21.y1est
rche25_p24.y1est
rthg34_d20.y1est
reep35c_l21.y1est
AJ681735est
rmed08c_i5.y1est
recc2805c_p22.y1est
BI245072est
BP461178est
rova008_o4.y1est
rcbl0_011857.y1est
rmcp21c_f13.y1est
BP160156est
BP163339est
rcsk12_b8.y1est
AJ955362est
BP168215est
rste34_e17.y1est
rlin35_f11.y1est
rnbm32b_j3.y1est
BW978808est
recc2807c_k23.y1est
rbdd_74572.y1reads
rnlu1815b_h1.y1est
rspl14_h20.y1est
AJ663035est
rthg20_l1.y1est
DN129289est
rspl34_o19.y1est
rova010_e2.y1est
BW967526est
recc2833c_c14.y1est
CF722856est
rmed30c_g2.y1est
BP151324est
BW973003est
rsin13_a2.y1est
BW983695est
rcsp31b_o24.y1est
DN126364est
rspl19_m3.y1est
BW982895est
reru30c_g7.y1est
BW979895est
rspl36_n21.y1est
BP169161est
BP164069est
BW974539est
rfbs3909b_g10.y1est
CB285885est
rpliv0104_e6.y1est
rcje01_i13.y1est
rlnt01c_e18.y1est
rthg18_k16.y1est
BW980607est
recc2819c_e12.y1est
reye1626b_o4r1.y1est
CA780789est
rcsp33b_g18.y1est
DV225791est
BW984100est
rcbl0_010378.y1est
rmed06c_j6.y1est
CA780556est
DN130214est
BP164809est
rpigca0_012063.y1est
rnbm10b_e6.y1est
BX926619est
BP162398est
reru12c_p7.y1est
relu1316b_a16r1.y1est
rova013_j8.y1est
rcmu12_p17.y1est
rmed10c_k7.y1est
rmed21c_d1.y1est
reep16c_f6.y1est
rcje10_c22.y1est
EST Library Info
cbl5Blood
che3Heart - RNA from China
cje5Jejunum - RNA from China
cmu2Rhinal mucous membrane - RNA from China
csk2Skin - RNA from China
csp4Spleen - RNA from China
ecc6Foetus 50 days, cortex cerebri
eep5Foetus 50 days, epidermis
eje4Foetus 50 days, jejunum
elu1Foetus 50 days, lung
eru4Foetus 50 days, regio umbilicalis
ese3Foetus 50 days, M. semitendinosus
eye1Foetus 50 days, Eye
fbs2Unavailable
lin3Large intestine
lnt2Lymphatic nodule tracheobroncalis
mcp2Mammae, collostrum producing
med13Mediastinum
mgp2Mammary gland - 7 days pre birth
nbm2Newborn 115 days, bone marrow (pelvis)
nco5Newborn 115 days, colon
ova5Ovary
pigca1Unavailable
pliv2Unavailable
relu2Unavailable
sin4Small intestine
ski1Skin
spl14Spleen
ste1M. Semitendinosus
tes2Testes
thg4Thyroid gland
Clusters
Oligos
SNPs

Gene ID ENSG00000164104 (click for geneview)
Transcript ID ENST00000296503(link to ensembl)
Symbol HMGB2
Localtion Chromosome:4:174627518:174630322:-1 band: 4q34.1
Description High mobility group protein 2 (HMG-2). [Source:Uniprot/SWISSPROT;Acc:P26583]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--K--G--D--P--N--K--P--R--G--K--M--S--S--Y--A--F--F--V--Q--T--C--R--E--E--H--K--K--K--H--P--D--
ATGGGTAAAGGAGACCCCAACAAGCCGCGGGGCAAAATGTCCTCGTACGCCTTCTTCGTGCAGACCTGCCGGGAAGAGCACAAGAAGAAACACCCGGACT
::::: ::.:: :::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::: ::.:
ATGGGGAAGGGCGACCCCAACAAGCCGCGGGGCAAGATGTCCTCGTACGCCTTCTTCGTGCAGACCTGCCGGGAGGAGCACAAGAAGAAACACCCCGATT
-M--G--K--G--D--P--N--K--P--R--G--K--M--S--S--Y--A--F--F--V--Q--T--C--R--E--E--H--K--K--K--H--P--D--

-------------------------------------------------><-------------------------------------------------
S--S--V--N--F--A--E--F--S--K--K--C--S--E--R--W--K--T--M--S--A--K--E--K--S--K--F--E--D--M--A--K--S--D
CTTCCGTCAATTTCGCGGAATTCTCCAAGAAGTGTTCGGAGAGATGGAAGACCATGTCTGCAAAGGAGAAGTCGAAGTTTGAAGATATGGCAAAAAGTGA
:.:: :::::.::::: ::.::::::::::::::.:: ::: ::::::::::.:::::::: :::::.::::: ::::::::::::::::::::::::::
CCTCGGTCAACTTCGCCGAGTTCTCCAAGAAGTGCTCCGAGCGATGGAAGACTATGTCTGCCAAGGAAAAGTCCAAGTTTGAAGATATGGCAAAAAGTGA
S--S--V--N--F--A--E--F--S--K--K--C--S--E--R--W--K--T--M--S--A--K--E--K--S--K--F--E--D--M--A--K--S--D

-----------------------------------------------------------------------------------------------><---
--K--A--R--Y--D--R--E--M--K--N--Y--V--P--P--K--G--D--K--K--G--K--K--K--D--P--N--A--P--K--R--P--P--S-
CAAAGCTCGCTATGACAGGGAGATGAAAAATTACGTTCCTCCCAAAGGTGATAAGAAGGGGAAGAAAAAGGACCCCAATGCTCCTAAAAGGCCACCATCT
:::::::::::::::: :::::::::::::::::::.::::::::.:::::.:::::::: ::::::::.::.:::::::::::.::::::      :::
CAAAGCTCGCTATGACCGGGAGATGAAAAATTACGTCCCTCCCAAGGGTGACAAGAAGGGCAAGAAAAAAGATCCCAATGCTCCCAAAAGG------TCT
--K--A--R--Y--D--R--E--M--K--N--Y--V--P--P--K--G--D--K--K--G--K--K--K--D--P--N--A--P--K--R--------S-

----------------------------------------------------------------------------------------------------
-A--F--F--L--F--C--S--E--H--R--P--K--I--K--S--E--H--P--G--L--S--I--G--D--T--A--K--K--L--G--E--M--W--
GCCTTCTTCCTGTTTTGCTCTGAACATCGCCCAAAGATCAAAAGTGAACACCCTGGCCTATCCATTGGGGATACTGCAAAGAAATTGGGTGAAATGTGGT
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::
GCCTTCTTCCTGTTTTGCTCTGAACATCGCCCAAAGATCAAAAGTGAACACCCTGGCTTATCCATTGGGGATACTGCAAAGAAATTGGGTGAAATGTGGT
-A--F--F--L--F--C--S--E--H--R--P--K--I--K--S--E--H--P--G--L--S--I--G--D--T--A--K--K--L--G--E--M--W--

----------------------------------------------------------------------><----------------------------
S--E--Q--S--A--K--D--K--Q--P--Y--E--Q--K--A--A--K--L--K--E--K--Y--E--K--D--I--A--A--Y--R--A--K--G--K
CTGAGCAGTCAGCCAAAGATAAACAACCATATGAACAGAAAGCAGCTAAGCTAAAGGAGAAATATGAAAAGGATATTGCTGCATATCGTGCCAAGGGCAA
::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.::::::::::::::::::::::::::.:::::::::::.::
CTGAGCAGTCAGCCAAAGATAAACAACCGTATGAACAGAAAGCAGCTAAGCTAAAGGAAAAATATGAAAAGGATATTGCTGCATACCGTGCCAAGGGTAA
S--E--Q--S--A--K--D--K--Q--P--Y--E--Q--K--A--A--K--L--K--E--K--Y--E--K--D--I--A--A--Y--R--A--K--G--K

----------------------------------------------------------------------------------------------------
--S--E--A--G--K--K--G--P--G--R--P--T--G--S--K--K--K--N--E--P--E--D--E--E--E--E--E--E--E--E-----D--E-
AAGTGAAGCAGGAAAGAAGGGCCCTGGCAGGCCAACAGGCTCAAAGAAGAAGAACGAACCAGAAGATGAGGAGGAGGAGGAGGAAGAAGAA---GATGAA
..:::::::::::::::::::::::::::::::::::::::: :::::::::::.::::::::::::::::::::.:::::.::.::.:::   ::::::
GGGTGAAGCAGGAAAGAAGGGCCCTGGCAGGCCAACAGGCTCTAAGAAGAAGAATGAACCAGAAGATGAGGAGGAAGAGGAAGAGGAGGAAGAAGATGAA
--G--E--A--G--K--K--G--P--G--R--P--T--G--S--K--K--K--N--E--P--E--D--E--E--E--E--E--E--E--E--E--D--E-

-------------------------------->
-D--E--E--E--E--D--E--D--E--E--*-
GATGAGGAGGAAGAGGATGAAGATGAAGAATAA
::.:::::::::::.:::::::::::.::::::
GACGAGGAGGAAGAAGATGAAGATGAGGAATAA
-D--E--E--E--E--D--E--D--E--E--*-

Pig Consensus Sequence

>BGISUST0000880124
ATGGGGAAGGGCGACCCCAACAAGCCGCGGGGCAAGATGTCCTCGTACGCCTTCTTCGTGCAGACCTGCCGGGAGGAGCACAAGAAGAAACACCCCGATT
CCTCGGTCAACTTCGCCGAGTTCTCCAAGAAGTGCTCCGAGCGATGGAAGACTATGTCTGCCAAGGAAAAGTCCAAGTTTGAAGATATGGCAAAAAGTGA
CAAAGCTCGCTATGACCGGGAGATGAAAAATTACGTCCCTCCCAAGGGTGACAAGAAGGGCAAGAAAAAAGATCCCAATGCTCCCAAAAGG------TCT
GCCTTCTTCCTGTTTTGCTCTGAACATCGCCCAAAGATCAAAAGTGAACACCCTGGCTTATCCATTGGGGATACTGCAAAGAAATTGGGTGAAATGTGGT
CTGAGCAGTCAGCCAAAGATAAACAACCGTATGAACAGAAAGCAGCTAAGCTAAAGGAAAAATATGAAAAGGATATTGCTGCATACCGTGCCAAGGGTAA
GGGTGAAGCAGGAAAGAAGGGCCCTGGCAGGCCAACAGGCTCTAAGAAGAAGAATGAACCAGAAGATGAGGAGGAAGAGGAAGAGGAGGAAGAAGATGAA
GACGAGGAGGAAGAAGATGAAGATGAGGAA


>BGISUSP0000880124
MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKR--S
AFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKGEAGKKGPGRPTGSKKKNEPEDEEEEEEEEEDE
DEEEEDEDEE