Sequences
EST Library Info
sin1Small intestine
thg1Thyroid gland
Clusters
Oligos
SNPs

Gene ID ENSG00000164118 (click for geneview)
Transcript ID ENST00000296519(link to ensembl)
Symbol KIAA1712
Localtion Chromosome:4:175594951:175616211:1 band: 4q34.1
Description KIAA1712 [Source:RefSeq_peptide;Acc:NP_085136]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<------------------------------------------------------------------------------------------><-------
-V--M--A--T--G--D--L--K--R--S--L--R--N--L--E--Q--V--L--R--L--L--N--Y--P--E--E--V--D--C--V--G--L--I--
GTAATGGCAACAGGTGACTTAAAAAGAAGCTTACGGAACCTAGAACAGGTGCTCCGCTTGCTAAATTATCCTGAAGAGGTGGACTGTGTAGGTTTGATAA
::::::::::::::::::::::::::::::::::::::::::::.::.:: ::.::::. ::::::::::::..:::::::::.::::::   :::.:::
GTAATGGCAACAGGTGACTTAAAAAGAAGCTTACGGAACCTAGAGCAAGTTCTTCGCTCTCTAAATTATCCTAGAGAGGTGGATTGTGTA---TTGGTAA
-V--M--A--T--G--D--L--K--R--S--L--R--N--L--E--Q--V--L--R--S--L--N--Y--P--R--E--V--D--C--V-----L--V--

----------------------------------------------------------------------------------------------------
K--G--D--P--A--A--S--L--P--I--I--S--Y--S--F--T--S--Y--S--P--Y--V--T--E--L--I--M--E--S--N--V--E--L--I
AGGGAGACCCAGCAGCATCTTTGCCCATCATCAGCTATTCTTTTACCTCATACTCACCTTATGTAACAGAACTTATAATGGAATCCAATGTAGAGCTCAT
:::: ::. .::::::::::::::::::::::::::::::..:::::::.::.::::::::::::.:::::::: :..::::.::::::::.::::::::
AGGGCGATATAGCAGCATCTTTGCCCATCATCAGCTATTCCCTTACCTCGTATTCACCTTATGTAGCAGAACTTCTGGTGGAGTCCAATGTGGAGCTCAT
K--G--D--I--A--A--S--L--P--I--I--S--Y--S--L--T--S--Y--S--P--Y--V--A--E--L--L--V--E--S--N--V--E--L--I

---------------------------------------><-----------------------------------------------------------
--A--K--N--D--L--R--F--I--D--A--V--Y--K--L--L--R--D--Q--F--N--Y--K--P--I--L--T--K--K--Q--F--I--Q--C-
AGCAAAAAATGACTTGCGCTTTATAGATGCTGTCTATAAGCTTCTTCGTGATCAATTTAATTATAAACCAATTTTGACAAAAAAGCAGTTTATCCAATGT
::::::.::.::::::::::::::::::.:::::::.::::::::::::::::: :::::::::::::::::.:::::::::::::::::: ::::.:::
AGCAAAGAACGACTTGCGCTTTATAGATACTGTCTACAAGCTTCTTCGTGATCATTTTAATTATAAACCAATCTTGACAAAAAAGCAGTTTCTCCAGTGT
--A--K--N--D--L--R--F--I--D--T--V--Y--K--L--L--R--D--H--F--N--Y--K--P--I--L--T--K--K--Q--F--L--Q--C-

--------------------------------------------------------------------------------------><------------
-G--F--A--E--W--K--I--Q--I--V--C--D--I--L--N--C--V--M--K--K--H--K--E--L--S--S--L--Q--K--I--P--S--Q--
GGGTTTGCAGAATGGAAAATCCAAATTGTTTGTGATATTTTGAATTGTGTGATGAAAAAGCACAAGGAATTAAGCAGTCTTCAGAAGATTCCATCACAAC
::.::::: ::::::::::::::::::.:::::::::::::.::::::::::::::::::::::::::.::.::..::::: :::::             
GGATTTGCTGAATGGAAAATCCAAATTATTTGTGATATTTTAAATTGTGTGATGAAAAAGCACAAGGAGTTGAGTGGTCTTGAGAAG-------------
-G--F--A--E--W--K--I--Q--I--I--C--D--I--L--N--C--V--M--K--K--H--K--E--L--S--G--L--E--K--------------

----------------------------------------------------------------------------------------------------
Q--R--K--K--I--S--S--G--K--S--E--P--P--L--G--N--E--K--I--S--A--E--A--V--G--V--D--I--S--G--R--F--M--T
AAAGAAAGAAAATCAGTTCTGGTAAGTCAGAACCTCCTTTGGGCAATGAGAAAATATCTGCAGAGGCTGTTGGCGTTGATATCAGTGGCAGGTTTATGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------><-----------------------------------------------------------------------------------------
--S--G--K--K--K--A--V--V--I--R--H--L--Y--N--E--D--N--V--D--I--S--E--D--T--L--S--P--I--T--D--V--N--E-
CTCAGGAAAGAAGAAAGCTGTGGTGATTCGTCACTTGTATAATGAAGATAATGTTGACATTTCTGAGGATACATTAAGTCCAATAACAGATGTTAATGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------><------------------
-A--V--D--V--S--D--L--N--A--T--E--I--K--M--P--E--V--K--V--P--E--I--K--A--E--Q--Q--D--V--N--V--N--P--
GCAGTTGATGTGTCTGACTTAAATGCTACTGAAATAAAGATGCCTGAAGTAAAGGTTCCTGAAATCAAGGCTGAGCAACAGGATGTAAATGTTAATCCTG
                                                                                 :::::::: ::.:::::::
---------------------------------------------------------------------------------GATGTAAAAGTCAATCCTG
----------------------------------------------------------------------------------D--V--K--V--N--P--

----------------------------------------------------------------------------------------------------
E--I--T--A--L--Q--T--M--L--A--E--C--Q--E--N--L--K--K--L--T--S--I--E--K--R--L--D--C--L--E--Q--K--M--K
AGATTACTGCACTACAAACTATGCTTGCTGAATGCCAAGAAAATCTTAAGAAACTGACTTCGATAGAGAAAAGGTTAGACTGTTTGGAACAAAAAATGAA
::::::::::::::::... ::::::::.:::::::::::::: ::::.:::::::::::   ::::::: ::.::::::: :::::::  .::::::::
AGATTACTGCACTACAGGTGATGCTTGCCGAATGCCAAGAAAAGCTTAGGAAACTGACTTGCCTAGAGAATAGATTAGACTCTTTGGAAACGAAAATGAA
E--I--T--A--L--Q--V--M--L--A--E--C--Q--E--K--L--R--K--L--T--C--L--E--N--R--L--D--S--L--E--T--K--M--K

---------------------------------------------------------------------------------------><-----------
--G--K--V--M--V--D--E--N--T--W--T--N--L--L--S--R--V--T--L--L--E--T--E--M--L--L--S--K--K--N--D--E--F-
AGGAAAAGTGATGGTAGATGAAAACACCTGGACTAATCTTCTTAGTCGTGTCACTCTTCTTGAAACAGAAATGCTTTTGTCTAAAAAGAATGATGAATTT
:::.:::::::::::..::::::: ::::::::.:::::::: :::::::::::::::::::::::::::::::::::.:::::::::            
AGGGAAAGTGATGGTGAATGAAAAAACCTGGACCAATCTTCTAAGTCGTGTCACTCTTCTTGAAACAGAAATGCTTTTATCTAAAAAG------------
--G--K--V--M--V--N--E--K--T--W--T--N--L--L--S--R--V--T--L--L--E--T--E--M--L--L--S--K--K-------------

---------------------------------------------------------------><-----------------------------------
-I--E--F--N--E--V--S--E--D--Y--A--S--C--S--D--M--D--L--L--N--P--H--R--K--S--E--V--E--R--P--A--S--I--
ATAGAGTTTAATGAAGTTAGTGAAGACTACGCTTCTTGTAGTGACATGGACCTTCTGAATCCTCACAGAAAAAGCGAAGTAGAGAGGCCAGCAAGTATTC
                                                                  ::::::::. ::: :::.:::: :::::.:::::
------------------------------------------------------------------AGAAAAAGTCAAGAAGAAAGGCAAGCAAATATTC
-------------------------------------------------------------------R--K--S--Q--E--E--R--Q--A--N--I--

----------------------------------------------------------------------------------------><----------
P--L--S--S--G--Y--S--T--A--S--S--D--S--T--P--R--A--S--T--V--N--Y--C--G--L--N--E--I--S--E--E--T--T--I
CTCTGTCCTCTGGCTATAGTACAGCATCATCAGATTCAACTCCCAGAGCCTCTACTGTTAATTACTGTGGTTTGAATGAGATTTCAGAGGAAACAACAAT
:::::::.:::::.::::::::::.::::::::::::::::::::::.:::: :::::::::::::.::::::::: :::::::::::::::::::::::
CTCTGTCTTCTGGTTATAGTACAGTATCATCAGATTCAACTCCCAGAACCTCAACTGTTAATTACTATGGTTTGAAAGAGATTTCAGAGGAAACAACAAT
P--L--S--S--G--Y--S--T--V--S--S--D--S--T--P--R--T--S--T--V--N--Y--Y--G--L--K--E--I--S--E--E--T--T--I

--------------------------><----------------------------------------------->
--Q--K--M--E--R--M--K--K--M--F--E--E--T--A--E--L--L--K--C--P--N--H--Y--L--*-
CCAGAAAATGGAAAGGATGAAAAAAATGTTTGAAGAAACTGCAGAGTTACTGAAATGTCCAAATCACTACTTGTAG
:::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::: ::.:::
CCAGAAAATGGAAAGGATGAAAAAA---TTTGAAGAAACTGCAGAGTTACTGAAATGTCCAAATCACTAATTATAG
--Q--K--M--E--R--M--K--K-----F--E--E--T--A--E--L--L--K--C--P--N--H--*--L--*-

Pig Consensus Sequence

>BGISUST0000886996
GTAATGGCAACAGGTGACTTAAAAAGAAGCTTACGGAACCTAGAGCAAGTTCTTCGCTCTCTAAATTATCCTAGAGAGGTGGATTGTGTA---TTGGTAA
AGGGCGATATAGCAGCATCTTTGCCCATCATCAGCTATTCCCTTACCTCGTATTCACCTTATGTAGCAGAACTTCTGGTGGAGTCCAATGTGGAGCTCAT
AGCAAAGAACGACTTGCGCTTTATAGATACTGTCTACAAGCTTCTTCGTGATCATTTTAATTATAAACCAATCTTGACAAAAAAGCAGTTTCTCCAGTGT
GGATTTGCTGAATGGAAAATCCAAATTATTTGTGATATTTTAAATTGTGTGATGAAAAAGCACAAGGAGTTGAGTGGTCTTGAGAAG-------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------GATGTAAAAGTCAATCCTG
AGATTACTGCACTACAGGTGATGCTTGCCGAATGCCAAGAAAAGCTTAGGAAACTGACTTGCCTAGAGAATAGATTAGACTCTTTGGAAACGAAAATGAA
AGGGAAAGTGATGGTGAATGAAAAAACCTGGACCAATCTTCTAAGTCGTGTCACTCTTCTTGAAACAGAAATGCTTTTATCTAAAAAG------------
------------------------------------------------------------------AGAAAAAGTCAAGAAGAAAGGCAAGCAAATATTC
CTCTGTCTTCTGGTTATAGTACAGTATCATCAGATTCAACTCCCAGAACCTCAACTGTTAATTACTATGGTTTGAAAGAGATTTCAGAGGAAACAACAAT
CCAGAAAATGGAAAGGATGAAAAAA---TTTGAAGAAACTGCAGAGTTACTGAAATGTCCAAATCACTAATTATAG


>BGISUSP0000886996
VMATGDLKRSLRNLEQVLRSLNYPREVDCV-LVKGDIAASLPIISYSLTSYSPYVAELLVESNVELIAKNDLRFIDTVYKLLRDHFNYKPILTKKQFLQC
GFAEWKIQIICDILNCVMKKHKELSGLEK-----------------------------------------------------------------------
---------------------------DVKVNPEITALQVMLAECQEKLRKLTCLENRLDSLETKMKGKVMVNEKTWTNLLSRVTLLETEMLLSKK----
----------------------RKSQEERQANIPLSSGYSTVSSDSTPRTSTVNYYGLKEISEETTIQKMERMKK-FEETAELLKCPNH*L*