Sequences
EST Library Info
pigcf1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000164796 (click for geneview)
Transcript ID ENST00000297405(link to ensembl)
Symbol CSMD3
Localtion Chromosome:8:113304337:114518418:-1 band: 8q23.3
Description CUB and sushi multiple domains protein 3 precursor. [Source:Uniprot/SWISSPROT;Acc:Q7Z407]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--I--K--S--G--F--T--F--W--N--L--V--F--L--L--T--V--S--C--V--K--R--C--A--K--C--G--R--L--D--F--I--
ATGAAAGGGATCCGCAAAGGGGAAAGCCGAGCAAAGGAATCCAAACCCTGGGAGCCTGGCAAGCGAAGATGCGCTAAATGTGGCCGCCTAGACTTCATCC
:::....  :   :...:   . .  ..:..     :  :..  :..   :: :.:: :.. : .:                                  
ATGGGGATTAAAAGTGGATTTACGTTTTGGAACCTCGTCTTTTTATTGACGGTGTCTTGTGTGAAA----------------------------------
-M--G--I--K--S--G--F--T--F--W--N--L--V--F--L--L--T--V--S--C--V--K-----------------------------------

-----------------------------------------------------------------------------><---------------------
L--M--K--K--M--G--I--K--S--G--F--T--F--W--N--L--V--F--L--L--T--V--S--C--V--K--G--F--I--Y--T--C--G--G
TGATGAAGAAAATGGGGATTAAAAGTGGATTTACGTTTTGGAACCTCGTCTTTTTATTGACGGTGTCTTGTGTGAAAGGATTTATTTATACATGTGGTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--L--K--G--L--N--G--T--I--E--S--P--G--F--P--Y--G--Y--P--N--G--A--N--C--T--W--V--I--I--A--E--E--R-
AACTTTAAAAGGACTTAATGGCACTATAGAAAGCCCTGGTTTTCCATATGGATATCCAAATGGTGCAAACTGCACATGGGTAATAATAGCAGAAGAACGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--R--I--Q--I--V--F--Q--S--F--A--L--E--E--E--Y--D--Y--L--S--L--Y--D--G--H--P--H--P--T--N--F--R--T--
AATAGAATACAAATTGTTTTTCAGTCATTTGCTCTAGAAGAAGAATACGACTACTTATCATTATATGATGGACATCCTCATCCTACAAACTTTAGGACAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

><--------------------------------------------------------------------------------------------------
R--L--T--G--F--H--L--P--P--P--V--T--S--T--K--S--V--F--S--L--R--L--T--S--D--F--A--V--S--A--H--G--F--K
GGTTAACAGGATTCCATCTGCCACCTCCAGTGACAAGTACCAAATCTGTGTTCTCACTACGTTTGACCAGTGATTTTGCAGTTAGTGCTCATGGATTTAA
  ::::::::::::::::::::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
--TTAACAGGATTCCATCTGCCACCACCAGTGACAAGTACCAAATCTGTGTTCTCACTACGTTTGACCAGTGATTTTGCAGTTAGTGCTCATGGATTTAA
---L--T--G--F--H--L--P--P--P--V--T--S--T--K--S--V--F--S--L--R--L--T--S--D--F--A--V--S--A--H--G--F--K

-------------><-------------------------------------------------------------------------------------
--V--Y--Y--E--E--L--Q--S--S--S--C--G--N--P--G--V--P--P--K--G--V--L--Y--G--T--R--F--D--V--G--D--K--I-
GGTATATTACGAAGAATTGCAGAGTAGCTCTTGTGGAAATCCTGGTGTTCCACCCAAAGGTGTATTATATGGCACAAGATTCGACGTCGGGGACAAGATC
.::::::::.:::   .::::::::::::::::::::::::: :: ::::::::.::::: :::::.:::::.:::::.:::::.::.::.:::::::::
AGTATATTATGAA---CTGCAGAGTAGCTCTTGTGGAAATCCAGGAGTTCCACCTAAAGGGGTATTGTATGGTACAAGGTTCGATGTTGGAGACAAGATC
--V--Y--Y--E-----L--Q--S--S--S--C--G--N--P--G--V--P--P--K--G--V--L--Y--G--T--R--F--D--V--G--D--K--I-

----------------------------------------------------------------------------------------------------
-R--Y--S--C--V--T--G--Y--I--L--D--G--H--P--Q--L--T--C--I--A--N--S--V--N--T--A--S--W--D--F--P--V--P--
CGCTACAGCTGTGTAACTGGATACATCCTTGATGGCCACCCTCAGCTCACCTGCATAGCCAATTCAGTTAATACAGCTTCGTGGGATTTTCCTGTTCCTA
:: ::::::::::::::::::::.:::                                                                         
CGATACAGCTGTGTAACTGGATATATC-------------------------------------------------------------------------
-R--Y--S--C--V--T--G--Y--I--------------------------------------------------------------------------

--------><------------------------------------------------------------------------------------------
I--C--R--A--E--D--A--C--G--G--T--M--R--G--S--S--G--I--I--S--S--P--S--F--P--N--E--Y--H--N--N--A--D--C
TCTGTAGAGCTGAAGATGCTTGTGGAGGAACAATGAGAGGATCCAGTGGCATCATATCCAGCCCTAGTTTTCCTAATGAGTACCATAACAATGCTGATTG
           :::::::: :::::::::::::::::::::::.:::::::::::::: :::::::::::::::::::::::::::::.:::::::::::
-----------GAAGATGCATGTGGAGGAACAATGAGAGGATCTAGTGGCATCATATCAAGCCCTAGTTTTCCTAATGAGTACCATAATAATGCTGATTG
------------E--D--A--C--G--G--T--M--R--G--S--S--G--I--I--S--S--P--S--F--P--N--E--Y--H--N--N--A--D--C

----------------------------------------------------------------------------------------------------
--T--W--T--I--V--A--E--P--G--D--T--I--S--L--I--F--T--D--F--Q--M--E--E--K--Y--D--Y--L--E--I--E--G--S-
CACTTGGACCATTGTAGCAGAGCCTGGGGACACAATTTCACTCATATTTACTGATTTTCAAATGGAAGAGAAATATGATTACTTAGAAATAGAAGGTTCT
:::::::::::::::::::::::::::.:::::::::::::::::::::::::::::.:::::::::::.::.:::::::::::::::::::::::::::
CACTTGGACCATTGTAGCAGAGCCTGGAGACACAATTTCACTCATATTTACTGATTTCCAAATGGAAGAAAAGTATGATTACTTAGAAATAGAAGGTTCT
--T--W--T--I--V--A--E--P--G--D--T--I--S--L--I--F--T--D--F--Q--M--E--E--K--Y--D--Y--L--E--I--E--G--S-

----------------><----------------------------------------------------------------------------------
-E--P--P--T--I--W--L--S--G--M--N--I--P--P--P--I--I--S--N--K--N--W--L--R--L--H--F--V--T--D--S--N--H--
GAGCCACCTACCATATGGTTATCTGGAATGAATATACCACCACCAATTATCAGCAACAAAAACTGGCTCAGACTGCATTTTGTTACAGACAGCAATCATC
::::::::::: :::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:
GAGCCACCTACAATA---TTATCTGGAATGAATATACCACCACCAATTATCAGCAACAAAAACTGGCTCAGACTGCATTTTGTTACAGACAGCAATCACC
-E--P--P--T--I-----L--S--G--M--N--I--P--P--P--I--I--S--N--K--N--W--L--R--L--H--F--V--T--D--S--N--H--

-----------------------------><---------------------------------------------------------------------
R--Y--R--G--F--S--A--P--Y--Q--G--S--S--T--L--T--H--T--T--S--T--G--E--L--E--E--H--N--R--T--T--T--G--A
GATACCGTGGATTTAGTGCTCCCTATCAAGGTTCTTCTACATTGACCCACACTACCTCCACTGGTGAGTTAGAGGAGCATAACAGGACTACCACTGGTGC
::::.:::::::::::::::::.::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GATATCGTGGATTTAGTGCTCCTTATCAA---TCTTCTACATTGACCCACACTACCTCCACTGGTGAGTTAGAGGAGCATAACAGGACTACCACTGGTGC
R--Y--R--G--F--S--A--P--Y--Q-----S--S--T--L--T--H--T--T--S--T--G--E--L--E--E--H--N--R--T--T--T--G--A

----------------------------------------------------------------------------------------------------
--I--A--V--A--S--T--P--A--D--V--T--V--S--S--V--T--A--V--T--I--H--R--L--S--E--E--Q--R--V--Q--V--T--S-
TATTGCTGTTGCTAGCACACCTGCAGATGTTACTGTATCCAGTGTTACAGCTGTCACCATCCATAGACTTTCCGAGGAACAGCGAGTGCAAGTTACGAGT
:::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::: : ::.:
TATTGCTGTTGCTAGCACATCTGCAGATGTTACTGTATCCAGTGTTACAGCTGTCACCATCCATAGACTTTCCGAGGAGCAGCGAGTGCAAGTAAAGAAT
--I--A--V--A--S--T--S--A--D--V--T--V--S--S--V--T--A--V--T--I--H--R--L--S--E--E--Q--R--V--Q--V--K--N-

----------------------------------------------------------------------------------------------------
-L--R--N--S--G--L--D--P--N--T--S--K--D--G--L--S--P--H--P--A--D--T--Q--S--T--R--R--R--P--R--H--A--E--
CTCAGAAATTCAGGTCTGGACCCCAACACGTCCAAGGACGGGCTCTCTCCTCATCCAGCAGATACACAAAGTACCAGGAGAAGACCAAGACATGCTGAAC
:::::::::::::::::::::::::::::.::::::::::::::. ::::::::: :::::::::::::::::: ::::::::::::::: :::::::::
CTCAGAAATTCAGGTCTGGACCCCAACACATCCAAGGACGGGCTTGCTCCTCATCAAGCAGATACACAAAGTACAAGGAGAAGACCAAGAAATGCTGAAC
-L--R--N--S--G--L--D--P--N--T--S--K--D--G--L--A--P--H--Q--A--D--T--Q--S--T--R--R--R--P--R--N--A--E--

-----------------------------------------><---------------------------------------------------------
Q--I--E--R--T--K--E--L--A--V--V--T--H--R--V--K--K--A--I--D--F--K--S--R--G--F--K--L--F--P--G--K--D--N
AGATAGAAAGAACTAAAGAGCTTGCAGTTGTTACTCATAGAGTGAAAAAGGCCATAGATTTTAAATCTAGAGGATTTAAATTGTTTCCAGGGAAAGACAA
:::::::::::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::::::::
AGATAGAAAGAACTAAAGAGCTTGCAGTTGTTACTCATAGA---AAAAAGGCCATAGATTTTAAATCTAGAGGATTTAAATTGTTTCCAGGGAAAGACAA
Q--I--E--R--T--K--E--L--A--V--V--T--H--R-----K--K--A--I--D--F--K--S--R--G--F--K--L--F--P--G--K--D--N

-------------------><-------------------------------------------------------------------------------
--S--N--K--F--S--I--L--N--E--G--G--I--K--T--A--S--N--L--C--P--D--P--G--E--P--E--N--G--K--R--I--G--S-
CAGCAACAAGTTTTCTATCTTAAATGAGGGAGGTATTAAAACAGCTTCCAATTTATGCCCAGATCCAGGAGAACCAGAAAATGGGAAGAGAATCGGATCA
:::::::::::::::::::   :::::.:::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::.:.::::::
CAGCAACAAGTTTTCTATC---AATGAAGGAGGTATTAAGACAGCTTCCAATTTATGCCCAGATCCAGGAGAACCAGAAAATGGGAAGAGAGTTGGATCA
--S--N--K--F--S--I-----N--E--G--G--I--K--T--A--S--N--L--C--P--D--P--G--E--P--E--N--G--K--R--V--G--S-

-------><-------------------------------------------------------------------------------------------
-D--F--S--L--G--S--T--V--Q--F--S--C--D--E--D--Y--V--L--Q--G--A--K--S--I--T--C--Q--R--I--A--E--V--F--
GATTTTAGCCTTGGATCAACTGTGCAGTTCTCTTGTGATGAAGATTATGTCCTACAGGGCGCAAAGAGCATCACCTGTCAACGGATAGCTGAAGTTTTTG
::::::   ::::::::::::::::::::::::::::::::::::::::::::::::::.:: ::::::::::::::::::::::::::::::::.::::
GATTTT---CTTGGATCAACTGTGCAGTTCTCTTGTGATGAAGATTATGTCCTACAGGGTGCTAAGAGCATCACCTGTCAACGGATAGCTGAAGTCTTTG
-D--F-----L--G--S--T--V--Q--F--S--C--D--E--D--Y--V--L--Q--G--A--K--S--I--T--C--Q--R--I--A--E--V--F--

--------------------------------><------------------------------------------------------------------
A--A--W--S--D--H--R--P--V--C--K--V--K--T--C--G--S--N--L--Q--G--P--S--G--T--F--T--S--P--N--F--P--F--Q
CTGCTTGGAGTGATCACAGGCCTGTGTGTAAAGTGAAAACGTGTGGCTCTAATCTTCAAGGACCAAGTGGTACCTTTACATCTCCCAACTTTCCGTTCCA
:::::::::::::::::::::: ::.::::::                                                                    
CTGCTTGGAGTGATCACAGGCCAGTATGTAAA--------------------------------------------------------------------
A--A--W--S--D--H--R--P--V--C--K---------------------------------------------------------------------

------------------------------------------------------><--------------------------------------------
--Y--D--S--N--A--Q--C--V--W--V--I--T--A--V--N--T--N--K--V--I--Q--I--N--F--E--E--F--D--L--E--I--G--Y-
GTATGACAGCAATGCACAATGTGTCTGGGTCATCACAGCAGTGAATACAAATAAGGTTATCCAGATAAATTTTGAAGAATTTGATCTGGAGATTGGCTAT
                                                       ::::::::::::::::::::::::::::::::::::::::::::.
-------------------------------------------------------GTTATCCAGATAAATTTTGAAGAATTTGATCTGGAGATTGGCTAC
--------------------------------------------------------V--I--Q--I--N--F--E--E--F--D--L--E--I--G--Y-

----------------------------------------------------------><----------------------------------------
-D--T--L--T--I--G--D--G--G--E--V--G--D--P--R--T--V--L--Q--V--L--T--G--S--F--V--P--D--L--I--V--S--M--
GATACCTTGACAATTGGCGATGGGGGCGAAGTTGGAGATCCTAGGACAGTGCTCCAAGTGCTGACTGGAAGCTTTGTACCAGACTTGATAGTGAGCATGA
:::::::::::::::::.:::::.::. ::::::::::.:: ::::: :::::::::   :: :::::::::::::: ::::::::.:::::::::::::
GATACCTTGACAATTGGTGATGGAGGTCAAGTTGGAGACCCAAGGACTGTGCTCCAA---CTTACTGGAAGCTTTGTCCCAGACTTAATAGTGAGCATGA
-D--T--L--T--I--G--D--G--G--Q--V--G--D--P--R--T--V--L--Q-----L--T--G--S--F--V--P--D--L--I--V--S--M--

--------------------------------------------------------------------------><------------------------
S--S--Q--M--W--L--H--L--Q--T--D--E--S--V--G--S--V--G--F--K--V-----N--Y--K--E--I--E--K--E--S--C--G--D
GTAGCCAAATGTGGCTGCACCTTCAAACGGACGAAAGTGTTGGATCTGTTGGTTTCAAGGTT---AACTACAAAGAAATTGAGAAAGAAAGTTGTGGTGA
:::::::::::::::: :::::::::::.::.::::::::::::::::::::.:::::::::   :::::.:::   :::::.:::::::::::::::::
GTAGCCAAATGTGGCTTCACCTTCAAACAGATGAAAGTGTTGGATCTGTTGGCTTCAAGGTTT--AACTATAAA---ATTGAAAAAGAAAGTTGTGGTGA
S--S--Q--M--W--L--H--L--Q--T--D--E--S--V--G--S--V--G--F--K--V--\--N--Y--K-----I--E--K--E--S--C--G--D

----------------------------------------------------------------------------------------------------
--P--G--T--P--L--Y--G--I--R--E--G--D--G--F--S--N--R--D--V--L--R--F--E--C--Q--F--G--F--E--L--I--G--E-
TCCTGGTACACCCTTATATGGAATTAGAGAAGGCGATGGATTTTCTAATCGTGATGTTTTAAGGTTTGAATGCCAGTTTGGGTTTGAATTAATTGGAGAG
:::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::
TCCTGGTACACCCTTATATGGAATTAGAGAAGGTGATGGATTTTCTAATCGTGATGTTTTAAGGTTTGAATGCCAGTTTGGATTTGAATTAATTGGAGAG
--P--G--T--P--L--Y--G--I--R--E--G--D--G--F--S--N--R--D--V--L--R--F--E--C--Q--F--G--F--E--L--I--G--E-

---------------------------------------------------------><-----------------------------------------
-K--S--I--V--C--Q--E--N--N--Q--W--S--A--N--I--P--I--C--I--F--P--C--L--S--N--F--T--A--P--M--G--T--V--
AAATCCATTGTTTGTCAAGAGAATAACCAATGGTCTGCAAACATACCCATCTGTATCTTTCCCTGCCTGTCTAACTTTACTGCACCAATGGGAACAGTTC
:::::::::::::::::::::::::::::.:::::::::::::::::::::::::::                                           
AAATCCATTGTTTGTCAAGAGAATAACCAGTGGTCTGCAAACATACCCATCTGTATC-------------------------------------------
-K--S--I--V--C--Q--E--N--N--Q--W--S--A--N--I--P--I--C--I--------------------------------------------

----------------------------------------------------------------------------------------------------
L--S--P--D--Y--P--E--G--Y--G--N--N--L--N--C--I--W--T--I--I--S--D--P--G--S--R--I--H--L--S--F--N--D--F
TTTCTCCTGATTACCCAGAAGGGTATGGAAATAATTTAAATTGCATCTGGACGATAATCTCTGATCCAGGGAGCCGGATACATCTTTCTTTCAATGACTT
                 ::::::::::::::::::::::: :::::::::::.:::::::::::::  .::::.::::::::.:::::.:::::::::::
-----------------GAAGGGTATGGAAATAATTTAAA-TGCATCTGGACAATAATCTCTGATCGCAGGAGTCGGATACACCTTTCCTTCAATGACTT
------------------E--G--Y--G--N--N--L--N--C--I--W--T--I--I--S--D--R--R--S--R--I--H--L--S--F--N--D--F

----------------------------------------------------------------------------------------------------
--D--L--E--S--Q--F--D--F--L--A--V--K--D--G--D--S--P--E--S--P--I--L--G--T--F--T--G--A--E--V--P--S--H-
TGACCTGGAATCCCAGTTTGATTTCCTTGCTGTTAAAGATGGTGACTCTCCAGAATCCCCAATTCTTGGAACCTTTACTGGGGCTGAGGTGCCTTCCCAT
:::.:::::::::::::::::.:::::::::::::::::::: ::.:::::::: ::::::::::::::::: :::::::::::::::::::::::.:::
TGATCTGGAATCCCAGTTTGACTTCCTTGCTGTTAAAGATGGGGATTCTCCAGACTCCCCAATTCTTGGAACATTTACTGGGGCTGAGGTGCCTTCTCAT
--D--L--E--S--Q--F--D--F--L--A--V--K--D--G--D--S--P--D--S--P--I--L--G--T--F--T--G--A--E--V--P--S--H-

---------------------------------------------------------------------------------------><-----------
-L--T--S--N--S--H--I--L--R--L--E--F--Q--A--D--H--S--M--S--G--R--G--F--N--I--T--Y--N--T--F--G--H--N--
CTTACTAGTAATAGTCACATACTGCGATTGGAATTTCAGGCTGACCACTCAATGTCAGGACGTGGCTTTAACATCACTTACAACACATTTGGACATAATG
:::::::::::.:::::.:::::.::::::::::::::.:::::.:::::.:::::::::::::::::::::::::::::.:::                
CTTACTAGTAACAGTCATATACTACGATTGGAATTTCAAGCTGATCACTCGATGTCAGGACGTGGCTTTAACATCACTTATAAC----------------
-L--T--S--N--S--H--I--L--R--L--E--F--Q--A--D--H--S--M--S--G--R--G--F--N--I--T--Y--N-----------------

----------------------------------------------------------------------------------------------------
E--C--P--D--P--G--I--P--I--N--A--R--R--F--G--D--N--F--Q--L--G--S--S--I--S--V--I--C--E--E--G--F--I--K
AATGCCCTGATCCTGGAATACCAATCAATGCACGGCGGTTTGGGGACAACTTTCAATTAGGAAGTTCAATTTCAGTTATTTGTGAAGAAGGATTTATTAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------><----------------
--T--Q--G--T--E--T--I--T--C--I--L--M--D--G--K--V--M--W--S--G--L--I--P--K--C--G--A--P--C--G--G--H--F-
AACCCAGGGAACAGAAACAATTACATGTATTCTTATGGATGGAAAAGTAATGTGGAGTGGACTGATTCCAAAATGTGGAGCCCCATGTGGTGGCCATTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--A--P--S--G--V--I--L--S--P--G--W--P--G--Y--Y--K--D--S--L--N--C--E--W--V--I--E--A--E--P--G--H--S--
TCAGCTCCCAGTGGAGTGATTCTCTCACCAGGATGGCCAGGATACTACAAAGACTCTTTGAATTGTGAGTGGGTGATTGAAGCTGAACCTGGACACTCTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------><-----------------------------------------------------------------------------
I--K--I--T--F--E--R--F--Q--T--E--L--N--Y--D--V--L--E--V--H--D--G--P--N--L--L--S--P--L--L--G--S--Y--N
TCAAAATTACATTTGAAAGATTTCAGACTGAACTGAATTATGATGTTCTGGAAGTTCATGATGGGCCAAATCTTCTGTCACCCTTGCTTGGATCTTACAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--T--Q--V--P--Q--F--L--F--S--S--S--N--F--I--Y--L--L--F--T--T--D--N--S--R--S--N--N--G--F--K--I--H-
TGGCACCCAAGTGCCCCAGTTTCTATTTAGTAGCAGTAATTTTATATACCTTCTATTTACAACAGACAACAGTCGTTCCAATAATGGTTTCAAGATTCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------><-----------------------------------------------------------------------------------------
-Y--E--S--V--T--V--N--T--Y--S--C--L--D--P--G--I--P--V--H--G--R--R--Y--G--H--D--F--S--I--G--S--T--V--
TATGAAAGTGTTACAGTGAACACGTATTCTTGTTTGGACCCTGGCATACCTGTACATGGCCGTCGCTATGGTCATGATTTCTCCATTGGCTCTACTGTTT
         :::::::::::::: ::::::::.:::::::::::.::::::::::::::.::::::::::::::::::::::::::::: ::::::::::
---------GTTACAGTGAACACCTATTCTTGCTTGGACCCTGGTATACCTGTACATGGTCGTCGCTATGGTCATGATTTCTCCATTGGATCTACTGTTT
----------V--T--V--N--T--Y--S--C--L--D--P--G--I--P--V--H--G--R--R--Y--G--H--D--F--S--I--G--S--T--V--

--------------------------------------------------------------------------------------------------><
S--F--S--C--D--S--G--Y--R--L--S--H--E--E--P--L--L--C--E--K--N--H--W--W--S--H--P--L--P--T--C--D--A--L
CATTTAGTTGTGATTCAGGATACAGGTTGAGTCATGAAGAGCCCCTTCTATGCGAAAAAAACCACTGGTGGAGTCATCCACTTCCAACCTGTGATGCATT
::::::::::::::.:::::::::::.:.::.:::::::::::.:::.::::.::.:::::::::::::::::::::::::::::::::::::::   ::
CATTTAGTTGTGATCCAGGATACAGGCTAAGCCATGAAGAGCCTCTTTTATGTGAGAAAAACCACTGGTGGAGTCATCCACTTCCAACCTGTGAT---TT
S--F--S--C--D--P--G--Y--R--L--S--H--E--E--P--L--L--C--E--K--N--H--W--W--S--H--P--L--P--T--C--D-----L

----------------------------------------------------------------------------------------------------
--C--G--G--D--V--R--G--P--S--G--T--I--L--S--P--G--Y--P--E--F--Y--P--N--S--L--N--C--T--W--T--V--D--V-
ATGTGGAGGAGATGTTAGAGGGCCTAGTGGAACAATCTTATCACCTGGTTACCCGGAATTTTATCCAAATTCTCTGAATTGTACATGGACTGTTGATGTA
:::::::::::::::::::::::::::::: :::::.:::::::::::::::::.:::::::::::::::::::::::::::::.:::::::::::::::
ATGTGGAGGAGATGTTAGAGGGCCTAGTGGCACAATTTTATCACCTGGTTACCCAGAATTTTATCCAAATTCTCTGAATTGTACGTGGACTGTTGATGTA
--C--G--G--D--V--R--G--P--S--G--T--I--L--S--P--G--Y--P--E--F--Y--P--N--S--L--N--C--T--W--T--V--D--V-

---------------><-----------------------------------------------------------------------------------
-T--H--G--K--G--V--Q--F--N--F--H--T--F--H--L--E--D--H--H--D--Y--L--L--I--T--E--N--G--S--F--T--Q--P--
ACCCATGGAAAAGGTGTGCAGTTCAACTTCCACACTTTTCATTTGGAAGACCATCATGACTACTTACTGATCACAGAGAATGGCAGTTTTACCCAACCAC
::::::::::::                                                                                        
ACCCATGGAAAA----------------------------------------------------------------------------------------
-T--H--G--K-----------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--A--R--L--T--G--S--D--L--P--P--T--I--N--A--G--L--Y--G--N--F--R--A--Q--L--R--F--I--S--D--F--S--I--S
TGGCACGCCTGACTGGTTCAGATCTTCCTCCAACAATCAATGCTGGTCTCTATGGAAATTTCAGGGCTCAATTGCGTTTCATTTCAGATTTTTCAATATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------><-------------------------------------------------------------------
--Y--E--G--F--N--I--T--F--S--E--Y--N--L--E--P--C--E--D--P--G--I--P--Q--Y--G--S--R--I--G--F--N--F--G-
ATATGAAGGATTTAACATAACATTCTCTGAATATAACCTTGAACCTTGTGAAGATCCTGGCATTCCTCAATATGGTAGTCGAATCGGGTTCAACTTTGGG
                               :::::::: ::::::::..:::::::::: :::::::::: ::: :..:::::.:::::::.::::::.
-------------------------------TATAACCTGGAACCTTGCAAAGATCCTGGAATTCCTCAATTTGGAAACCGAATTGGGTTCAGCTTTGGA
--------------------------------Y--N--L--E--P--C--K--D--P--G--I--P--Q--F--G--N--R--I--G--F--S--F--G-

----------------------------------------------------------------------------------------------------
-I--G--D--T--L--T--F--S--C--S--S--G--Y--R--L--E--G--T--S--E--I--I--C--L--G--G--G--R--R--V--W--S--A--
ATTGGTGACACTCTGACCTTCTCATGCTCTTCGGGTTATCGACTGGAAGGAACATCAGAGATCATCTGTCTTGGTGGTGGCCGACGAGTGTGGAGTGCAC
.:::::::::::::::::::::::::::: ::.:::::::: ::::::::.::.::::::::::::::::::::::::::::::::::::::::::::::
GTTGGTGACACTCTGACCTTCTCATGCTCATCAGGTTATCGTCTGGAAGGGACGTCAGAGATCATCTGTCTTGGTGGTGGCCGACGAGTGTGGAGTGCAC
-V--G--D--T--L--T--F--S--C--S--S--G--Y--R--L--E--G--T--S--E--I--I--C--L--G--G--G--R--R--V--W--S--A--

--------------------><------------------------------------------------------------------------------
P--L--P--R--C--V--A--E--C--G--A--S--A--T--N--N--E--G--I--L--L--S--P--N--Y--P--L--N--Y--E--N--N--H--E
CTCTGCCAAGGTGTGTGGCTGAATGTGGTGCATCTGCAACGAATAATGAAGGAATTTTGCTGTCTCCAAATTATCCACTCAACTATGAAAACAACCATGA
:::::::::::::::::   ::::::::::::::::::::.:::::::::::.:::: ::: ::::::::::::::::::::::::.:::::::::::::
CTCTGCCAAGGTGTGTG---GAATGTGGTGCATCTGCAACAAATAATGAAGGGATTTAGCTCTCTCCAAATTATCCACTCAACTATAAAAACAACCATGA
P--L--P--R--C--V-----E--C--G--A--S--A--T--N--N--E--G--I--*--L--S--P--N--Y--P--L--N--Y--K--N--N--H--E

------------------------------------------------------------------------------------------><--------
--C--I--Y--S--I--Q--V--Q--A--G--K--G--I--N--I--S--A--R--T--F--H--L--A--Q--G--D--V--L--K--I--Y--D--G-
ATGCATTTATAGTATTCAGGTTCAAGCAGGAAAGGGAATCAATATTTCAGCCAGAACATTTCATTTAGCACAAGGAGATGTTCTTAAGATTTATGATGGA
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ATGCATTTATAGTATTCAGGTTCAAGCAGGAAAGGGAATCAATATTTCAGCCAGAACATTTCATTTAGCACAAGGAGATGTTCTTAAGATTTATGATGGA
--C--I--Y--S--I--Q--V--Q--A--G--K--G--I--N--I--S--A--R--T--F--H--L--A--Q--G--D--V--L--K--I--Y--D--G-

----------------------------------------------------------------------------------------------------
-K--D--K--T--T--H--L--L--G--A--F--T--G--A--S--M--R--G--L--T--L--S--S--T--S--N--Q--L--W--L--E--F--N--
AAAGATAAAACGACTCATCTACTAGGTGCTTTTACTGGTGCATCTATGCGCGGACTGACACTTAGTAGTACTTCAAATCAACTCTGGCTAGAATTTAATT
:::::.:::::.:::::::::::::::::::::::::::::::::::: : ::::::::::::::::::::::::::.::.:::::::::::::::::::
AAAGACAAAACAACTCATCTACTAGGTGCTTTTACTGGTGCATCTATGAGAGGACTGACACTTAGTAGTACTTCAAACCAGCTCTGGCTAGAATTTAATT
-K--D--K--T--T--H--L--L--G--A--F--T--G--A--S--M--R--G--L--T--L--S--S--T--S--N--Q--L--W--L--E--F--N--

-----------------------------------------------><---------------------------------------------------
S--D--T--E--G--T--D--E--G--F--Q--L--V--Y--T--S--F--E--L--S--H--C--E--D--P--G--I--P--Q--F--G--Y--K--I
CCGATACTGAAGGGACAGATGAAGGCTTTCAACTTGTGTATACCAGTTTTGAACTCTCACACTGTGAAGATCCTGGCATTCCACAATTTGGATACAAGAT
:.::: :::::::::: :::::::::::::::::::: ::::::                                                        
CTGATTCTGAAGGGACCGATGAAGGCTTTCAACTTGTCTATACC--------------------------------------------------------
S--D--S--E--G--T--D--E--G--F--Q--L--V--Y--T---------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--D--Q--G--H--F--A--G--S--T--I--I--Y--G--C--N--P--G--Y--T--L--H--G--S--S--L--L--K--C--M--T--G--E-
CAGTGACCAAGGCCACTTTGCTGGTAGCACCATCATTTATGGATGCAATCCAGGCTACACTCTCCACGGAAGTAGCCTTCTCAAGTGCATGACAGGGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------><-----------------------------------------------------------
-R--R--A--W--D--Y--P--L--P--S--C--I--A--E--C--G--G--R--F--K--G--E--S--S--G--R--I--L--S--P--G--Y--P--
AGAAGGGCATGGGACTATCCTCTGCCTTCCTGTATTGCTGAATGTGGAGGTCGTTTTAAAGGAGAATCATCAGGAAGAATCTTATCTCCTGGCTATCCTT
                                       :::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::.:
---------------------------------------GAATGTGGAGGTCGTTTTAAAGGAGAATCATCAGGAAGAATCTTATCTCCTGGTTATCCCT
----------------------------------------E--C--G--G--R--F--K--G--E--S--S--G--R--I--L--S--P--G--Y--P--

------------------------------------------------------------------><--------------------------------
F--P--Y--D--N--N--L--R--C--M--W--M--I--E--V--D--P--G--N--I--V--S--L--Q--F--L--A--F--D--T--E--A--S--H
TTCCATATGACAATAACCTGCGTTGCATGTGGATGATTGAGGTAGATCCTGGAAATATTGTCAGCTTGCAGTTTCTTGCTTTTGATACGGAAGCATCACA
::::::::::: ::::.:::::::::::::::.:::::::::: ::::: :::::.::::::   .:.::::::::::::::::::::::::::::::::
TTCCATATGACNATAATCTGCGTTGCATGTGGGTGATTGAGGTTGATCCAGGAAACATTGTC---CTACAGTTTCTTGCTTTTGATACGGAAGCATCACA
F--P--Y--D--X--N--L--R--C--M--W--V--I--E--V--D--P--G--N--I--V-----L--Q--F--L--A--F--D--T--E--A--S--H

----------------------------------------------------------------------------------------------------
--D--I--L--R--V--W--D--G--P--P--E--N--D--M--L--L--K--E--I--S--G--S--L--I--P--E--G--I--H--S--T--L--N-
TGATATACTCCGAGTCTGGGACGGTCCACCAGAAAATGATATGCTTTTAAAGGAAATTAGTGGATCTCTTATTCCTGAAGGAATTCATAGCACCCTCAAT
:::::::::::::::.:::::.::::::::::::::::: :::::::::::::::::::::::::::::.::::::::::::::.::.:::::::::::.
TGATATACTCCGAGTTTGGGATGGTCCACCAGAAAATGAGATGCTTTTAAAGGAAATTAGTGGATCTCTCATTCCTGAAGGAATCCACAGCACCCTCAAC
--D--I--L--R--V--W--D--G--P--P--E--N--E--M--L--L--K--E--I--S--G--S--L--I--P--E--G--I--H--S--T--L--N-

---------------------------------------------------------------------><-----------------------------
-I--V--T--I--Q--F--D--T--D--F--Y--I--S--K--S--G--F--A--I--Q--F--S--S--S--V--A--T--A--C--R--D--P--G--
ATAGTAACCATCCAGTTTGACACGGATTTTTATATTAGCAAATCTGGATTTGCAATTCAGTTTTCAAGTTCTGTTGCCACTGCGTGTCGTGACCCAGGGG
::::: ::::: :::::::::::::::::.:::::.::::::::::::::::::::::::::::::                                  
ATAGTCACCATACAGTTTGACACGGATTTCTATATCAGCAAATCTGGATTTGCAATTCAGTTTTCA----------------------------------
-I--V--T--I--Q--F--D--T--D--F--Y--I--S--K--S--G--F--A--I--Q--F--S-----------------------------------

----------------------------------------------------------------------------------------------------
V--P--M--N--G--T--R--N--G--D--G--R--E--P--G--D--T--V--V--F--Q--C--D--P--G--Y--E--L--Q--G--E--E--R--I
TCCCCATGAATGGGACTCGAAATGGGGATGGAAGAGAACCTGGGGACACTGTTGTTTTTCAATGTGACCCAGGATATGAACTTCAAGGAGAGGAAAGAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------><-------------------------------------
--T--C--I--Q--V--E--N--R--Y--F--W--Q--P--S--P--P--V--C--I--A--P--C--G--G--N--L--T--G--S-----S--G--F-
AACCTGCATTCAGGTAGAAAATCGGTACTTCTGGCAGCCCAGCCCACCAGTCTGTATAGCACCCTGTGGAGGCAATTTAACAGGATCT---TCAGGCTTT
                                                             ::::::::::::::.::.::: ..  :   . .:  :::
-------------------------------------------------------------CCCTGTGGAGGCAACTTGACACAGGATCTTCAGGCATTT
--------------------------------------------------------------P--C--G--G--N--L--T--Q--D--L--Q--A--F-

----------------------------------------------------------------------------------------------------
-I--L--S--P--N--F--P--H--P--Y--P--H--S--R--D--C--D--W--T--I--T--V--N--A--D--Y--V--I--S--L--A--F--I--
ATTCTTTCACCAAACTTCCCTCATCCATATCCGCATAGCAGAGACTGTGACTGGACTATCACCGTCAATGCAGACTATGTTATCTCCTTGGCGTTCATCA
:::::::: ::::::::.::::::::.::::: ::.:::::.::.::::::::::::                                           
ATTCTTTCCCCAAACTTTCCTCATCCGTATCCCCACAGCAGGGATTGTGACTGGACT-------------------------------------------
-I--L--S--P--N--F--P--H--P--Y--P--H--S--R--D--C--D--W--T--------------------------------------------

---><-----------------------------------------------------------------------------------------------
S--F--S--I--E--P--N--Y--D--F--L--Y--I--Y--D--G--P--D--S--N--S--P--L--I--G--S--F--Q--D--S--K--L--P--E
GTTTTAGCATAGAACCAAACTATGACTTCCTCTATATCTATGATGGACCAGACAGTAATAGCCCACTGATTGGAAGTTTTCAAGACAGCAAGTTACCAGA
  ::::::::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::
--TTTAGCATAGAACCAAACTATGACTTCCTCTATATATATGATGGACCAGACAGTAATAGCCCACTAATTGGAAGTTTTCAAGACAGCAAGTTACCAGA
---F--S--I--E--P--N--Y--D--F--L--Y--I--Y--D--G--P--D--S--N--S--P--L--I--G--S--F--Q--D--S--K--L--P--E

-------------------------------------------------------------------------------------------><-------
--R--I--E--S--S--S--N--T--M--H--L--A--F--R--S--D--G--S--V--S--Y--T--G--F--H--L--E--Y--K--A--K--L--R-
GAGAATAGAAAGCAGCTCAAATACAATGCATTTGGCTTTTCGGAGTGATGGATCTGTTAGTTACACTGGATTTCATCTAGAATACAAAGCAAAACTGCGA
:::::::::::::::::::::.:: :::::::.:::::::::::::::::::::::::::::::::::::::::::.:::::::.:::            
GAGAATAGAAAGCAGCTCAAACACCATGCATTCGGCTTTTCGGAGTGATGGATCTGTTAGTTACACTGGATTTCATTTAGAATATAAA------------
--R--I--E--S--S--S--N--T--M--H--S--A--F--R--S--D--G--S--V--S--Y--T--G--F--H--L--E--Y--K-------------

----------------------------------------------------------------------------------------------------
-E--S--C--F--D--P--G--N--I--M--N--G--T--R--L--G--M--D--Y--K--L--G--S--T--V--T--Y--Y--C--D--A--G--Y--
GAGTCCTGCTTTGATCCAGGCAATATAATGAATGGCACCAGACTTGGAATGGATTATAAATTAGGGTCAACAGTCACCTATTACTGTGATGCTGGTTATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------------------------------------------><------------
V--L--Q--G--Y--S--T--L--T--C--I--M--G--D--D--G--R--P--G--W--N--R--A--L--P--S--C--H--A--P--C--G--S--R
TTCTTCAAGGTTATTCAACACTCACCTGTATCATGGGAGATGATGGAAGACCTGGATGGAATAGAGCCTTGCCAAGTTGTCATGCGCCCTGTGGAAGTCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--T--G--S--E--G--T--V--L--S--P--N--Y--P--K--N--Y--S--V--G--H--N--C--V--Y--S--I--A--V--P--K--E--F-
TTCAACAGGTTCAGAAGGCACTGTTCTATCACCAAACTATCCAAAAAATTACAGTGTGGGACATAATTGTGTTTATTCTATAGCAGTTCCAAAGGAGTTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---><-----------------------------------------------------------------------------------------------
-V--V--F--G--Q--F--V--F--F--Q--T--S--L--H--D--V--V--E--V--Y--D--G--P--T--Q--Q--S--S--L--L--S--S--L--
GTGGTGTTTGGCCAGTTTGTATTTTTCCAGACATCACTCCACGATGTTGTTGAGGTGTATGATGGGCCAACTCAGCAATCTTCTCTGTTATCTTCCCTCT
   :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
---GTGTTTGGCCAGTTTGTATTTTTCCAGACATCACTCCACGATGTTGTTGAGGTGTATGATGGGCCAACTCAGCAATCTTCTCTGTTATCTTCCCTCT
----V--F--G--Q--F--V--F--F--Q--T--S--L--H--D--V--V--E--V--Y--D--G--P--T--Q--Q--S--S--L--L--S--S--L--

-----------------><---------------------------------------------------------------------------------
S--G--S--H--S--G--E--S--L--P--L--S--S--G--N--Q--I--T--I--R--F--T--S--V--G--P--I--T--A--K--G--F--H--F
CAGGATCCCATTCAGGAGAATCACTTCCACTGAGTTCAGGTAATCAGATCACAATTCGATTTACTTCAGTTGGACCAATAACAGCTAAGGGATTTCACTT
::::::::::::::                                                                                      
CAGGATCCCATTCA--------------------------------------------------------------------------------------
S--G--S--H--S---------------------------------------------------------------------------------------

-------------><-------------------------------------------------------------------------------------
--V--Y--Q--A--V--P--R--T--S--S--T--Q--C--S--S--V--P--E--P--R--F--G--R--R--I--G--N--E--F--A--V--G--S-
TGTTTACCAAGCTGTTCCTAGAACAAGTTCTACACAATGCAGTTCTGTGCCTGAACCAAGATTCGGAAGAAGAATTGGCAATGAATTTGCAGTCGGTTCA
                                                    ::::::::.::.::::::::.::::::::::::::::::::.::::::
----------------------------------------------------GAACCAAGGTTTGGAAGAAGGATTGGCAATGAATTTGCAGTTGGTTCA
-----------------------------------------------------E--P--R--F--G--R--R--I--G--N--E--F--A--V--G--S-

----------------------------------------------------------------------------------------------------
-S--V--L--F--D--C--N--P--G--Y--I--L--H--G--S--I--A--I--R--C--E--T--V--P--N--S--L--A--Q--W--N--D--S--
TCGGTTCTTTTTGATTGTAATCCAGGATATATTCTCCATGGATCCATAGCAATTAGGTGTGAAACAGTGCCCAATTCTTTGGCCCAGTGGAATGATTCCT
:.:::::::::::: :::::::::::::::::.:::::::::::::: :::::::::::::: :::::::: ::::::::::::::::::::::::::::
TTGGTTCTTTTTGAATGTAATCCAGGATATATCCTCCATGGATCCATTGCAATTAGGTGTGATACAGTGCCGAATTCTTTGGCCCAGTGGAATGATTCCT
-L--V--L--F--E--C--N--P--G--Y--I--L--H--G--S--I--A--I--R--C--D--T--V--P--N--S--L--A--Q--W--N--D--S--

-----------------><---------------------------------------------------------------------------------
L--P--T--C--I--V--P--C--G--G--I--L--T--K--R--K--G--T--I--L--S--P--G--Y--P--E--P--Y--D--N--N--L--N--C
TACCTACTTGTATTGTGCCCTGTGGTGGAATTTTAACTAAGCGCAAAGGGACTATTTTGTCACCTGGATACCCTGAGCCTTATGACAACAATCTGAATTG
:::::::.::::::                                                                                      
TACCTACCTGTATT--------------------------------------------------------------------------------------
L--P--T--C--I---------------------------------------------------------------------------------------

------------------------------------------><--------------------------------------------------------
--V--W--K--I--T--V--P--E--G--A--G--I--Q--V--Q--V--V--S--F--A--T--E--H--N--W--D--S--L--D--F--Y--D--G-
TGTGTGGAAGATCACAGTGCCAGAGGGAGCTGGCATTCAAGTGCAAGTTGTTAGCTTTGCTACAGAACATAATTGGGATTCTCTGGACTTTTATGATGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------><-----------------------------------------------------------
-G--D--N--N--A--P--R--L--G--S--Y--S--G--T--T--I--P--H--L--L--N--S--T--S--N--N--L--Y--L--N--F--Q--S--
GGAGACAACAATGCTCCAAGACTTGGAAGCTATTCAGGAACAACAATACCCCATCTTTTGAATAGTACGTCTAATAATCTGTATCTAAATTTTCAATCAG
                                       ::::::::::::::::::::::::::::: :::::::::::.:::::::::::::::::::
---------------------------------------ACAACAATACCCCATCTTTTGAATAGTACCTCTAATAATCTATATCTAAATTTTCAATCAG
----------------------------------------T--T--I--P--H--L--L--N--S--T--S--N--N--L--Y--L--N--F--Q--S--

--------------------------------------------><------------------------------------------------------
D--I--S--V--S--A--A--G--F--H--L--E--Y--T--A--I--G--L--D--S--C--P--E--P--Q--T--P--S--S--G--I--K--I--G
ACATCAGTGTTTCTGCTGCAGGATTTCATCTTGAATACACAGCAATTGGTTTGGATTCCTGTCCTGAACCACAAACTCCTAGCAGTGGAATTAAAATTGG
::::::::::::::::::::::::::::.::::::::::::   ::::::.:::::::::::::::::::::::::::::::::::::::::::::::::
ACATCAGTGTTTCTGCTGCAGGATTTCACCTTGAATACACA---ATTGGTCTGGATTCCTGTCCTGAACCACAAACTCCTAGCAGTGGAATTAAAATTGG
D--I--S--V--S--A--A--G--F--H--L--E--Y--T-----I--G--L--D--S--C--P--E--P--Q--T--P--S--S--G--I--K--I--G

---------------------------------------------------------------><-----------------------------------
--D--R--Y--M--V--G--D--V--V--S--F--Q--C--D--Q--G--Y--S--L--Q--G--H--S--H--I--T--C--M--P--G--P--V--R-
AGACAGATATATGGTTGGAGATGTAGTATCCTTTCAGTGTGATCAAGGATATTCTCTTCAGGGTCACTCTCACATTACATGTATGCCAGGACCTGTAAGA
:::::::::.:::::::: ::::::::::::::::::::::::::::: :::::::::::::::::.:::::.::::::::::::::::::::::: :::
AGACAGATACATGGTTGGTGATGTAGTATCCTTTCAGTGTGATCAAGGCTATTCTCTTCAGGGTCATTCTCATATTACATGTATGCCAGGACCTGTCAGA
--D--R--Y--M--V--G--D--V--V--S--F--Q--C--D--Q--G--Y--S--L--Q--G--H--S--H--I--T--C--M--P--G--P--V--R-

---------------------------------><-----------------------------------------------------------------
-R--W--N--Y--P--I--P--I--C--L--A--Q--C--G--G--A--M--S--D--F--S--G--V--I--L--S--P--G--F--P--G--N--Y--
AGATGGAATTATCCAATCCCAATTTGTTTAGCTCAGTGTGGTGGTGCTATGTCAGACTTCAGTGGTGTGATCCTCAGTCCTGGGTTTCCTGGAAACTATC
:::::::::::.:::::::::::::::                                                      :::::::::::::::::.:
AGATGGAATTACCCAATCCCAATTTGT------------------------------------------------------GGGTTTCCTGGAAACTACC
-R--W--N--Y--P--I--P--I--C--------------------------------------------------------G--F--P--G--N--Y--

--------------------------------------------------><------------------------------------------------
P--S--S--L--D--C--T--W--T--I--N--L--P--I--G--F--G--V--H--L--Q--F--V--N--F--S--T--E--T--I--H--D--Y--L
CCAGCAGTTTAGATTGCACATGGACAATAAATCTACCCATAGGTTTTGGTGTACATCTCCAGTTTGTAAATTTTTCTACAGAAACCATACATGATTATTT
:::::::::::::::::::.::::::::: : ::.::..:.::::::   :::::::: :::::::::::::::::::::::::::::::::::::::::
CCAGCAGTTTAGATTGCACGTGGACAATACAGCTGCCTGTGGGTTTT---GTACATCTGCAGTTTGTAAATTTTTCTACAGAAACCATACATGATTATTT
P--S--S--L--D--C--T--W--T--I--Q--L--P--V--G--F-----V--H--L--Q--F--V--N--F--S--T--E--T--I--H--D--Y--L

----------------------------------------------------------------------------------------------------
--E--V--R--S--G--S--S--E--T--S--T--V--I--G--R--L--S--G--P--Q--I--P--S--S--L--F--S--T--T--H--E--T--S-
GGAAGTACGAAGTGGATCCTCAGAAACTAGTACTGTTATTGGCCGGCTTAGTGGTCCTCAAATACCATCTTCCTTATTCAGCACCACCCATGAAACCAGC
::::::: :::::::::::::::::::::::::::::::::::::.::::::::::::::::::::.:::::..::::.::::: :::::::::::::::
GGAAGTAAGAAGTGGATCCTCAGAAACTAGTACTGTTATTGGCCGACTTAGTGGTCCTCAAATACCGTCTTCTCTATTTAGCACAACCCATGAAACCAGC
--E--V--R--S--G--S--S--E--T--S--T--V--I--G--R--L--S--G--P--Q--I--P--S--S--L--F--S--T--T--H--E--T--S-

------------------------------------------------------------><--------------------------------------
-L--Y--F--H--S--D--Y--S--Q--N--K--Q--G--F--H--I--V--Y--Q--A--Y--Q--L--Q--S--C--P--D--P--R--P--F--R--
TTATATTTTCACAGTGACTATTCACAAAACAAACAAGGGTTTCATATTGTATACCAAGCCTATCAGTTGCAAAGCTGTCCTGATCCACGCCCGTTTCGAA
::.::::::::::::::::::::::::                                                                         
TTGTATTTTCACAGTGACTATTCACAA-------------------------------------------------------------------------
-L--Y--F--H--S--D--Y--S--Q--------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
N--G--F--V--I--G--N--D--F--T--V--G--Q--T--I--S--F--E--C--F--P--G--Y--T--L--I--G--N--S--A--L--T--C--L
ATGGTTTTGTAATTGGTAATGATTTTACTGTGGGTCAAACCATTTCATTTGAATGTTTCCCAGGATACACATTAATTGGAAATTCAGCTCTCACATGCCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------><-------------------------------------------------
--H--G--V--S--R--N--W--N--H--P--L--P--R--C--E--A--L--C--G--G--N--I--T--A--M--N--G--T--I--Y--S--P--G-
TCACGGAGTCAGTCGTAATTGGAATCATCCACTTCCAAGGTGTGAAGCTCTTTGTGGTGGGAATATAACTGCAATGAATGGCACCATTTATTCTCCTGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Y--P--D--E--Y--P--N--F--Q--D--C--F--W--L--V--R--V--P--P--G--N--G--I--Y--I--N--F--T--V--L--Q--T--E--
TATCCTGATGAATATCCAAACTTTCAAGATTGTTTTTGGCTTGTAAGAGTACCCCCTGGGAATGGCATCTACATCAATTTTACTGTCCTTCAAACAGAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------><-----------------------------------------------------------------------
P--I--Y--D--F--I--T--V--W--D--G--P--D--Q--N--S--P--Q--I--G--Q--F--S--G--N--T--A--L--E--S--V--Y--S--T
CAATATATGATTTCATTACTGTATGGGATGGACCAGACCAAAATTCACCTCAGATCGGTCAGTTCAGTGGCAATACCGCTTTGGAATCAGTCTACAGTAC
                          :::::::::::::::::.::::: :::::.:: ::.::::::::::::::.:::::::::::::: :::::.::
--------------------------GATGGACCAGACCAAAACTCACCACAGATTGGGCAATTCAGTGGCAATACTGCTTTGGAATCAGTGTACAGCAC
---------------------------D--G--P--D--Q--N--S--P--Q--I--G--Q--F--S--G--N--T--A--L--E--S--V--Y--S--T

-------------------------------------------------------------------------><-------------------------
--S--N--Q--I--L--I--K--F--H--S--D--F--T--T--S--G--F--F--V--L--S--Y--H--A--Y--Q--L--R--V--C--Q--P--P-
TTCAAATCAGATTCTAATCAAATTCCACAGTGATTTCACAACAAGTGGCTTTTTTGTGCTCAGTTATCACGCCTATCAACTAAGGGTGTGCCAACCTCCA
::::::::::::::::::::::::.::::::::::::::.::::::::::::::.:::::::::         :::::::: ::.:::::.:::::::::
TTCAAATCAGATTCTAATCAAATTTCACAGTGATTTCACGACAAGTGGCTTTTTCGTGCTCAGT---------TATCAACTCAGAGTGTGTCAACCTCCA
--S--N--Q--I--L--I--K--F--H--S--D--F--T--T--S--G--F--F--V--L--S-----------Y--Q--L--R--V--C--Q--P--P-

------------------------------------------------------><--------------------------------------------
-P--P--V--P--N--A--E--I--L--T--E--D--D--E--F--E--I--G--D--I--I--R--Y--Q--C--L--P--G--F--T--L--V--G--
CCACCTGTGCCCAATGCTGAAATTTTGACGGAAGATGATGAATTTGAAATAGGTGATATTATTAGGTATCAGTGTCTTCCAGGATTTACTTTAGTTGGTA
:::::.::.::::::::::::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::.:::::::
CCACCCGTACCCAATGCTGAAATTTTGACGGAAGATGATGAATTTGAAATA---GATATTATTAGGTATCAGTGTCTTCCAGGATTTACTTTGGTTGGTA
-P--P--V--P--N--A--E--I--L--T--E--D--D--E--F--E--I-----D--I--I--R--Y--Q--C--L--P--G--F--T--L--V--G--

--------------------------------------------------------------------><------------------------------
N--A--I--L--T--C--R--L--G--E--R--L--Q--M--D--G--A--P--P--V--C--Q--V--L--C--P--A--N--E--L--R--L--D--S
ATGCAATTCTGACGTGCAGATTAGGAGAACGACTGCAGATGGATGGAGCACCTCCAGTTTGTCAAGTGCTCTGTCCTGCCAATGAATTACGGCTAGATTC
::::.::::::::.::::::::::::::: :::: ::::::::::::::::::::::::::::::   ::::::::::::::::::::::: ::.:::::
ATGCGATTCTGACATGCAGATTAGGAGAAAGACTCCAGATGGATGGAGCACCTCCAGTTTGTCAA---CTCTGTCCTGCCAATGAATTACGCCTGGATTC
N--A--I--L--T--C--R--L--G--E--R--L--Q--M--D--G--A--P--P--V--C--Q-----L--C--P--A--N--E--L--R--L--D--S

----------------------------------------------------------------------------------------------------
--T--G--V--I--L--S--P--G--Y--P--D--S--Y--P--N--L--Q--M--C--A--W--S--I--S--V--E--K--G--Y--N--I--T--M-
TACTGGAGTCATATTGAGCCCTGGATATCCTGACAGTTACCCAAATCTTCAAATGTGTGCATGGAGCATTTCAGTGGAAAAGGGTTATAATATCACCATG
::: :::::::::::::::::::::::::::::::::::::::::::::::.:::::::: :::::.:: :: ::::::::.:: ::. :.:::: ::::
TACAGGAGTCATATTGAGCCCTGGATATCCTGACAGTTACCCAAATCTTCAGATGTGTGCTTGGAGTATATCTGTGGAAAAAGGATACCACATCAGCATG
--T--G--V--I--L--S--P--G--Y--P--D--S--Y--P--N--L--Q--M--C--A--W--S--I--S--V--E--K--G--Y--H--I--S--M-

---------------------------------------------------------><-----------------------------------------
-F--V--E--F--F--Q--T--E--K--E--F--D--V--L--Q--V--Y--D--G--P--N--I--Q--S--P--V--L--I--S--L--S--G--D--
TTTGTAGAATTCTTCCAGACAGAAAAGGAATTTGATGTTCTTCAGGTGTATGATGGACCAAATATTCAAAGTCCAGTGCTTATTTCCCTCAGTGGGGATT
::::::::.:::::::::::::::::::::::::::::::::::::::::::::                                              
TTTGTAGAGTTCTTCCAGACAGAAAAGGAATTTGATGTTCTTCAGGTGTATGAT----------------------------------------------
-F--V--E--F--F--Q--T--E--K--E--F--D--V--L--Q--V--Y--D-----------------------------------------------

----------------------------------------------------------------------------------------------------
Y--S--S--A--F--N--I--T--S--N--G--H--E--V--F--L--Q--W--S--A--D--H--G--N--N--K--K--G--F--R--I--R--Y--I
ATTCATCTGCTTTTAATATAACAAGCAATGGTCATGAAGTATTTCTTCAGTGGTCAGCAGATCATGGCAATAACAAAAAAGGCTTCCGGATAAGATATAT
                 ::::::::::::::::::::::::::::::::.:::::::::::::::::.::::::::::::::::::::::::::::::::
-----------------ATAACAAGCAATGGTCATGAAGTATTTCTTCAATGGTCAGCAGATCATGGTAATAACAAAAAAGGCTTCCGGATAAGATATAT
------------------I--T--S--N--G--H--E--V--F--L--Q--W--S--A--D--H--G--N--N--K--K--G--F--R--I--R--Y--I

----><----------------------------------------------------------------------------------------------
--A--F--Y--C--S--T--P--E--S--P--P--H--G--Y--I--I--S--Q--T--G--G--Q--L--N--S--V--V--R--W--A--C--D--R-
AGCTTTCTACTGTAGTACACCAGAATCCCCACCTCATGGATATATTATCAGTCAGACAGGTGGGCAGCTTAACAGTGTGGTCCGTTGGGCCTGTGATCGA
:   :::::.::::::::::: ::::: :::::::::::::::::::::::::::::::::::.::::::::.:::::::::::.:::::::::::::::
A---TTCTATTGTAGTACACCCGAATCACCACCTCATGGATATATTATCAGTCAGACAGGTGGACAGCTTAATAGTGTGGTCCGCTGGGCCTGTGATCGA
-----F--Y--C--S--T--P--E--S--P--P--H--G--Y--I--I--S--Q--T--G--G--Q--L--N--S--V--V--R--W--A--C--D--R-

---------------------------------------------------------------------------------------------><-----
-G--F--R--L--V--G--K--S--S--A--V--C--R--K--S--S--Y--G--Y--H--A--W--D--A--P--V--P--A--C--Q--A--I--S--
GGATTCCGACTTGTTGGAAAAAGCAGTGCTGTGTGCAGAAAGTCTTCCTATGGGTATCATGCATGGGATGCGCCAGTCCCTGCCTGTCAAGCAATTTCCT
:::::::::::::::::.::.:::::.::::::::::::::.:::::::::::.:::::.:::::::::::.::.::::::::.:::      :::::::
GGATTCCGACTTGTTGGGAAGAGCAGCGCTGTGTGCAGAAAATCTTCCTATGGATATCACGCATGGGATGCACCGGTCCCTGCTTGT------ATTTCCT
-G--F--R--L--V--G--K--S--S--A--V--C--R--K--S--S--Y--G--Y--H--A--W--D--A--P--V--P--A--C--------I--S--

----------------------------------------------------------------------------------------------------
C--G--I--P--K--A--P--T--N--G--G--I--L--T--T--D--Y--L--V--G--T--R--V--T--Y--F--C--N--D--G--Y--R--L--S
GTGGGATTCCTAAAGCTCCAACAAATGGAGGAATACTAACAACAGACTATTTGGTAGGAACGCGAGTTACCTATTTTTGTAATGATGGATATCGATTGTC
::::::::::::::::::::::::::::::::::::: :::::::::::.::::::::::: :::::::::::::::::::::::::::::: :::::::
GTGGGATTCCTAAAGCTCCAACAAATGGAGGAATACTCACAACAGACTACTTGGTAGGAACCCGAGTTACCTATTTTTGTAATGATGGATATAGATTGTC
C--G--I--P--K--A--P--T--N--G--G--I--L--T--T--D--Y--L--V--G--T--R--V--T--Y--F--C--N--D--G--Y--R--L--S

-------------------------------------------------------------------------------><-------------------
--S--K--E--L--T--T--A--V--C--Q--S--D--G--T--W--S--N--H--N--K--T--P--R--C--V--V--V--T--C--P--S--I--N-
ATCCAAAGAACTCACTACAGCTGTATGCCAATCAGATGGAACATGGAGCAATCATAACAAGACCCCTCGCTGTGTTGTTGTTACATGTCCAAGCATCAAT
:::.::.::.::.::.:: ::.:::::.::::::                                             ::::::::::::::::::::.
ATCTAAGGAGCTTACCACTGCCGTATGTCAATCA---------------------------------------------GTTACATGTCCAAGCATCAAC
--S--K--E--L--T--T--A--V--C--Q--S-----------------------------------------------V--T--C--P--S--I--N-

----------------------------------------------------------------------------------------------------
-S--F--I--L--E--H--G--R--W--R--I--V--N--G--S--H--Y--E--Y--K--T--K--V--V--F--S--C--D--P--G--Y--H--G--
TCCTTTATCTTGGAACATGGAAGATGGCGAATTGTGAATGGCTCCCATTATGAATACAAAACCAAAGTAGTTTTCAGCTGTGACCCTGGTTATCATGGAC
:::::::..::::::::::::::.::: :::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::::
TCCTTTACTTTGGAACATGGAAGGTGGAGAATTGTGAATGGCTCCCATTATGAATACAAAACCAAGGTAGTTTTCAGCTGTGACCCTGGTTATCATGGAC
-S--F--T--L--E--H--G--R--W--R--I--V--N--G--S--H--Y--E--Y--K--T--K--V--V--F--S--C--D--P--G--Y--H--G--

--------------------------------------------------------------------------><------------------------
L--G--P--A--S--I--E--C--L--P--N--G--T--W--S--W--R--N--E--R--P--Y--C--Q--I--I--S--C--G--E--L--P--T--P
TAGGTCCTGCCTCCATCGAATGTCTTCCTAATGGTACTTGGAGTTGGAGAAATGAAAGACCATATTGCCAAATTATTTCCTGTGGAGAACTACCTACACC
::::::::::.:: ::.::.:::::::::::::::::.:::::::::::::::::::::::::::::::::                             
TAGGTCCTGCTTCAATTGAGTGTCTTCCTAATGGTACCTGGAGTTGGAGAAATGAAAGACCATATTGCCAA-----------------------------
L--G--P--A--S--I--E--C--L--P--N--G--T--W--S--W--R--N--E--R--P--Y--C--Q------------------------------

----------------------------------------------------------------------------------------------------
--P--N--G--N--K--I--G--T--Q--T--S--Y--G--S--T--A--I--F--T--C--D--L--G--F--M--L--V--G--S--A--V--R--E-
TCCAAATGGAAATAAGATTGGAACTCAAACTTCATATGGCTCAACAGCTATCTTTACCTGCGACTTGGGATTCATGCTTGTGGGCTCTGCTGTAAGGGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------><--------------------------------------------------
-C--L--S--S--G--L--W--S--E--S--E--T--R--C--L--A--G--H--C--G--I--P--E--L--I--V--N--G--Q--V--I--G--E--
TGCCTTTCCTCAGGTCTTTGGAGTGAATCTGAAACCAGATGCCTAGCGGGTCATTGTGGAATTCCAGAACTGATTGTGAATGGTCAAGTCATTGGAGAAA
                                                :::::.::::::.:::::::.:: ::::: ::::::::::::::::::::::
------------------------------------------------GGTCACTGTGGAGTTCCAGAGCTTATTGTTAATGGTCAAGTCATTGGAGAAA
-------------------------------------------------G--H--C--G--V--P--E--L--I--V--N--G--Q--V--I--G--E--

----------------------------------------------------------------------------------------------------
N--Y--G--Y--R--D--T--V--V--Y--Q--C--N--P--G--F--R--L--I--G--S--S--V--R--I--C--Q--Q--D--H--N--W--S--G
ATTATGGATATAGAGACACAGTTGTATATCAATGTAATCCTGGTTTTCGATTGATTGGTTCTTCAGTGAGGATATGTCAACAGGATCACAATTGGTCTGG
::::::::::.:::::::: ::::: ::.:::::::::::::::::::::.:::::::::::::::::::.::::::::::::::::::::.::::::::
ATTATGGATACAGAGACACTGTTGTTTACCAATGTAATCCTGGTTTTCGACTGATTGGTTCTTCAGTGAGAATATGTCAACAGGATCACAACTGGTCTGG
N--Y--G--Y--R--D--T--V--V--Y--Q--C--N--P--G--F--R--L--I--G--S--S--V--R--I--C--Q--Q--D--H--N--W--S--G

----------------------><----------------------------------------------------------------------------
--Q--L--P--S--C--V--P--V--S--C--G--H--P--G--S--P--I--Y--G--R--T--S--G--N--G--F--N--F--N--D--V--V--T-
TCAGCTCCCATCCTGTGTGCCTGTTAGCTGTGGTCACCCTGGTAGTCCAATTTATGGAAGAACAAGTGGAAATGGGTTCAACTTTAATGATGTGGTAACA
:::.::.::::::::::::   :: :::::::::::.::::: :::::::::::::::::.::::::::::::::.::::::::.:::::::::::::::
TCAACTTCCATCCTGTGTG---GTGAGCTGTGGTCATCCTGGAAGTCCAATTTATGGAAGGACAAGTGGAAATGGATTCAACTTCAATGATGTGGTAACA
--Q--L--P--S--C--V-----V--S--C--G--H--P--G--S--P--I--Y--G--R--T--S--G--N--G--F--N--F--N--D--V--V--T-

------------------------------------------------------------------------------------------------><--
-F--S--C--N--I--G--Y--L--M--Q--G--P--T--K--A--Q--C--Q--A--N--R--Q--W--S--H--P--P--P--M--C--K--V--V--
TTCTCATGCAATATTGGGTATCTTATGCAAGGGCCAACAAAGGCACAGTGCCAGGCCAACAGACAGTGGAGCCATCCTCCACCTATGTGCAAAGTGGTCA
::::: :::::.:.:::::::::.:::::::::::::::::.::::::::.:::::::::::::::::::::::::::::::: .::::::::   ::::
TTCTCTTGCAACACTGGGTATCTCATGCAAGGGCCAACAAAAGCACAGTGTCAGGCCAACAGACAGTGGAGCCATCCTCCACCAGTGTGCAAA---GTCA
-F--S--C--N--T--G--Y--L--M--Q--G--P--T--K--A--Q--C--Q--A--N--R--Q--W--S--H--P--P--P--V--C--K-----V--

----------------------------------------------------------------------------------------------------
N--C--S--D--P--G--I--P--A--N--S--K--R--E--S--K--I--E--H--G--N--F--T--Y--G--T--V--V--F--Y--D--C--N--P
ACTGTTCTGATCCTGGAATTCCAGCCAATTCTAAAAGAGAAAGTAAAATAGAACATGGAAATTTTACTTACGGCACTGTGGTATTCTATGACTGCAATCC
:::::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::::.:::::.::.:::::::::::::::::::::::::::::
ACTGTTCTGATCCTGGAATTCCAGCTAATTCCAAAAGAGAAAGTAAAATAGAACATGGAAACTTTACCTATGGCACTGTGGTATTCTATGACTGCAATCC
N--C--S--D--P--G--I--P--A--N--S--K--R--E--S--K--I--E--H--G--N--F--T--Y--G--T--V--V--F--Y--D--C--N--P

----------------------------------------------------------------------------------><----------------
--G--Y--F--L--F--G--S--S--V--L--I--C--Q--P--N--G--Q--W--D--K--P--L--P--E--C--I--M--I--D--C--G--H--P-
TGGATATTTTTTATTTGGATCTTCAGTTTTGATATGTCAACCAAATGGACAATGGGACAAACCTTTACCAGAATGTATCATGATTGACTGTGGACACCCT
:::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   ::::::::.:::::::::
TGGATATTTCTTATTTGGATCTTCAGTTTTGATATGTCAACCAAATGGACAATGGGACAAACCTTTACCAGAATGTATC---ATTGACTGCGGACACCCT
--G--Y--F--L--F--G--S--S--V--L--I--C--Q--P--N--G--Q--W--D--K--P--L--P--E--C--I-----I--D--C--G--H--P-

----------------------------------------------------------------------------------------------------
-G--V--P--P--N--A--V--L--S--G--E--K--Y--T--F--G--S--T--V--H--Y--S--C--T--G--K--R--S--L--L--G--Q--S--
GGCGTTCCTCCTAATGCAGTCCTGTCTGGCGAGAAGTATACTTTTGGGTCTACTGTTCACTATTCCTGCACAGGAAAGCGTTCCCTTTTAGGCCAGTCAT
:::::::::::::::::::::::::::::.:::::::::::.::::::::.:::::::::::::::::::::::::::::: :::::.::::::::::::
GGCGTTCCTCCTAATGCAGTCCTGTCTGGTGAGAAGTATACCTTTGGGTCCACTGTTCACTATTCCTGCACAGGAAAGCGTACCCTTCTAGGCCAGTCAT
-G--V--P--P--N--A--V--L--S--G--E--K--Y--T--F--G--S--T--V--H--Y--S--C--T--G--K--R--T--L--L--G--Q--S--

--------------------------------------------------------><------------------------------------------
S--R--T--C--Q--L--N--G--H--W--S--G--S--Q--P--H--C--S--G--D--A--T--G--T--C--G--D--P--G--T--P--G--H--G
CAAGAACCTGCCAATTGAATGGCCATTGGAGTGGATCACAACCTCATTGTTCAGGTGATGCTACTGGGACATGTGGCGATCCAGGTACTCCCGGCCATGG
::::.::.::::::::.::::::::::::::::::::::::::::::::::::                                               
CAAGGACTTGCCAATTAAATGGCCATTGGAGTGGATCACAACCTCATTGTTCA-----------------------------------------------
S--R--T--C--Q--L--N--G--H--W--S--G--S--Q--P--H--C--S------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--R--Q--E--S--N--F--R--T--K--S--T--V--R--Y--A--C--D--T--G--Y--I--L--H--G--S--E--E--R--T--C--L--A-
CTCTAGACAGGAAAGCAATTTCAGAACTAAAAGTACTGTACGTTATGCTTGTGATACTGGTTACATCCTTCATGGCTCAGAAGAAAGAACATGTTTAGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------><-----------------------------------------------------------
-N--G--S--W--T--G--R--Q--P--E--C--K--A--V--Q--C--G--N--P--G--T--T--A--N--G--K--V--F--R--I--D--G--T--
AATGGCAGTTGGACCGGAAGGCAGCCAGAGTGCAAAGCTGTGCAGTGTGGTAACCCAGGAACCACAGCCAATGGGAAAGTCTTCCGAATTGATGGCACAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--F--S--S--S--V--I--Y--S--C--M--E--G--Y--I--L--S--G--P--S--V--R--Q--C--T--A--N--G--T--W--S--G--T--L
CATTTTCTAGTTCAGTCATTTATTCCTGCATGGAGGGATACATCCTTTCTGGACCTTCAGTTAGACAGTGCACAGCCAATGGAACATGGTCTGGAACTTT
        :::::::::::.:::::::::::.::. ::::.:::::::::::::::::::::::.: ::::::::::.::::::::::::::::::::::
--------AGTTCAGTCATCTATTCCTGCATAGAATGATATATCCTTTCTGGACCTTCAGTTAGGCCGTGCACAGCCGATGGAACATGGTCTGGAACTTT
---------S--S--V--I--Y--S--C--I--E--*--Y--I--L--S--G--P--S--V--R--P--C--T--A--D--G--T--W--S--G--T--L

----------------><----------------------------------------------------------------------------------
--P--N--C--T--I--I--S--C--G--D--P--G--I--P--A--N--G--L--R--Y--G--D--D--Y--V--V--G--Q-----N--V--S--Y-
ACCTAACTGTACAATAATCAGTTGTGGAGACCCAGGTATACCAGCCAATGGACTGAGATATGGAGATGATTATGTGGTTGGACAA---AATGTTTCTTAC
.::::::::::::   ::::::::::. .. ::::::::::::::::::::::::::::::::::::::::::::::::::.::.   :::::::::::.
GCCTAACTGTACA---ATCAGTTGTGA-AGACCAGGTATACCAGCCAATGGACTGAGATATGGAGATGATTATGTGGTTGGGCAGA--AATGTTTCTTAT
--P--N--C--T-----I--S--C--G--R--P--G--I--P--A--N--G--L--R--Y--G--D--D--Y--V--V--G--Q--\--N--V--S--Y-

----------------------------------------------------------------------------------------------------
-M--C--Q--P--G--Y--T--M--E--L--N--G--S--R--I--R--T--C--T--I--N--G--T--W--S--G--V--M--P--T--C--R--A--
ATGTGCCAGCCAGGCTACACGATGGAATTGAATGGCTCCAGAATCAGGACTTGTACAATTAATGGCACATGGAGTGGAGTAATGCCAACTTGTAGAGCTG
:::::::::::::::::.::.::::::::::::::.:: ::::::::::::::::: :. ::::::::::::::::::::::::::::::::.:::    
ATGTGCCAGCCAGGCTATACAATGGAATTGAATGGTTCGAGAATCAGGACTTGTACTACGAATGGCACATGGAGTGGAGTAATGCCAACTTGCAGA----
-M--C--Q--P--G--Y--T--M--E--L--N--G--S--R--I--R--T--C--T--T--N--G--T--W--S--G--V--M--P--T--C--R-----

--><------------------------------------------------------------------------------------------------
V--T--C--P--T--P--P--Q--I--S--N--G--R--L--E--G--T--N--F--D--W--G--F--S--I--S--Y--I--C--S--P--G--Y--E
TTACCTGCCCAACTCCTCCCCAGATCTCTAATGGAAGGCTGGAAGGAACAAATTTCGACTGGGGCTTTAGTATTAGCTACATCTGTTCTCCAGGCTATGA
     :::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::
-----TGCCCAACTCCTCCCCAGATCTCTAATGGAAGGTTGGAAGGAACAAATTTCGACTGGGGCTTTAGCATTAGCTACATCTGTTCTCCAGGCTATGA
------C--P--T--P--P--Q--I--S--N--G--R--L--E--G--T--N--F--D--W--G--F--S--I--S--Y--I--C--S--P--G--Y--E

----------------------------------------------------------------------------><----------------------
--L--S--F--P--A--V--L--T--C--V--G--N--G--T--W--S--G--E--V--P--Q--C--L--P--K--F--C--G--D--P--G--I--P-
GCTATCCTTCCCTGCTGTTTTGACCTGTGTAGGGAATGGTACCTGGAGTGGTGAAGTACCGCAGTGCTTACCAAAGTTTTGTGGTGACCCTGGTATACCT
.::::::::.:::::::::::::::::::::::.::::::::::::::::: ::::::::.:::::::::   ::::::::::::::::::::.:::::.
ACTATCCTTTCCTGCTGTTTTGACCTGTGTAGGAAATGGTACCTGGAGTGGGGAAGTACCACAGTGCTTA---AAGTTTTGTGGTGACCCTGGCATACCC
--L--S--F--P--A--V--L--T--C--V--G--N--G--T--W--S--G--E--V--P--Q--C--L-----K--F--C--G--D--P--G--I--P-

----------------------------------------------------------------------------------------------------
-A--Q--G--K--R--E--G--K--S--F--I--Y--Q--S--E--V--S--F--S--C--N--F--P--F--I--L--V--G--S--S--T--R--I--
GCCCAAGGAAAAAGAGAAGGCAAAAGCTTTATATACCAGTCAGAGGTTTCATTCAGCTGCAATTTTCCTTTCATATTAGTGGGATCAAGCACCAGAATAT
::::::::.:::::::::::::::::::::::::::::.:::::::::::::::::::::::.:.:::::::::::::::::::::.:::::.:::::::
GCCCAAGGGAAAAGAGAAGGCAAAAGCTTTATATACCAATCAGAGGTTTCATTCAGCTGCAACTCTCCTTTCATATTAGTGGGATCGAGCACTAGAATAT
-A--Q--G--K--R--E--G--K--S--F--I--Y--Q--S--E--V--S--F--S--C--N--S--P--F--I--L--V--G--S--S--T--R--I--

--------------------------------------------------><------------------------------------------------
C--Q--A--D--G--T--W--S--G--S--S--P--H--C--I--E--P--T--Q--T--S--C--E--N--P--G--V--P--R--H--G--S--Q--N
GTCAAGCAGATGGCACTTGGAGTGGTTCATCACCTCACTGCATAGAGCCTACCCAAACCTCTTGTGAAAACCCAGGTGTGCCTCGGCATGGATCTCAGAA
::::::::::::::::::::::::::::::::::::::::::::                                                        
GTCAAGCAGATGGCACTTGGAGTGGTTCATCACCTCACTGCATA--------------------------------------------------------
C--Q--A--D--G--T--W--S--G--S--S--P--H--C--I---------------------------------------------------------

------------------------><--------------------------------------------------------------------------
--N--T--F--G--F--Q--V--G--S--V--V--Q--F--H--C--K--K--G--H--L--L--Q--G--S--T--T--R--T--C--L--P--D--L-
CAATACATTCGGATTTCAAGTAGGAAGTGTTGTACAGTTCCATTGCAAAAAAGGACACCTTCTCCAAGGGTCTACAACACGCACCTGCCTCCCTGATCTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------><--------------------------------------------------------------
-T--W--S--G--I--Q--P--E--C--I--P--H--S--C--K--Q--P--E--T--P--A--H--A--N--V--V--G--M--D--L--P--S--H--
ACGTGGAGTGGGATTCAGCCTGAATGCATACCCCACAGCTGTAAACAGCCAGAAACTCCTGCTCATGCAAATGTCGTAGGGATGGACCTTCCATCTCATG
                                                            :::::::::::::: :::::.::::::::.:::::.::::
------------------------------------------------------------GCTCATGCAAATGTAGTAGGAATGGACCTCCCATCCCATG
-------------------------------------------------------------A--H--A--N--V--V--G--M--D--L--P--S--H--

----------------------------------------------------------------------------------------------------
G--Y--T--L--I--Y--T--C--Q--P--G--F--F--L--A--G--G--T--E--H--R--V--C--R--S--D--N--T--W--T--G--K--V--P
GGTATACACTGATTTATACCTGTCAGCCTGGCTTCTTCTTAGCAGGTGGAACAGAACATAGAGTGTGTAGATCCGATAACACCTGGACTGGAAAAGTTCC
::::::::.:.:: ::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::
GGTATACATTAATATATACCTGCCAGCCTGGCTTCTTCTTAGCAGGTGGAACAGAACATAGAGTGTGTAGATCTGATAACACCTGGACTGGAAAAGTTCC
G--Y--T--L--I--Y--T--C--Q--P--G--F--F--L--A--G--G--T--E--H--R--V--C--R--S--D--N--T--W--T--G--K--V--P

----------------><----------------------------------------------------------------><----------------
--I--C--E--A--G--S--K--I--L--V--K--D--P--R--P--A--L--G--T--P--S--P--K--L--S--V--P--D--D--V--F--A--Q-
CATTTGTGAAGCTGGTTCTAAAATATTGGTGAAAGATCCTAGACCTGCACTGGGAACACCCAGCCCAAAGCTAAGTGTTCCTGATGATGTATTTGCCCAA
..::::::::                                                                                          
TGTTTGTGAA------------------------------------------------------------------------------------------
--V--C--E-------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-N--Y--I--W--K--G--S--Y--N--F--K--G--R--K--Q--P--M--T--L--T--V--T--S--F--N--A--S--T--G--R--V--N--A--
AATTATATATGGAAAGGCTCTTACAATTTCAAAGGAAGGAAACAACCCATGACCTTAACAGTTACTAGTTTCAATGCTTCCACTGGGAGAGTTAACGCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------------------><---------------------------------------------------------
T--L--S--N--S--N--M--E--L--L--L--S--G--V--Y--K--S--Q--E--A--R--L--M--L--R--I--Y--L--I--K--V--P--A--H
CACTGAGCAATAGCAACATGGAGCTGCTACTTTCAGGGGTATATAAAAGCCAGGAAGCTCGCCTAATGTTACGCATATATCTTATTAAAGTACCTGCTCA
                                      :::::.::::::::.:::::::::::::::::::.::: ::::::::::::::::: :::::
--------------------------------------GTATACAAAAGCCAAGAAGCTCGCCTAATGTTACACATTTATCTTATTAAAGTACCAGCTCA
---------------------------------------V--Y--K--S--Q--E--A--R--L--M--L--H--I--Y--L--I--K--V--P--A--H

------------------------------------------------------><--------------------------------------------
--A--S--V--K--K--M--K--E--E--N--W--A--M--D--G--F--V--S--A--E--P--D--G--A--T--Y--V--F--Q--G--F--I--Q-
TGCTTCTGTGAAGAAAATGAAGGAAGAAAATTGGGCAATGGATGGCTTTGTTTCTGCTGAGCCTGATGGAGCTACTTATGTATTTCAAGGATTTATTCAA
:::::::::.::::::::::::::.::::::.:::: :::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::.::.
TGCTTCTGTAAAGAAAATGAAGGAGGAAAATCGGGCCATGGATGGCTTTGTTTCTGCTGAACCTGATGGAGCTACTTATGTATTTCAAGGATTTATCCAG
--A--S--V--K--K--M--K--E--E--N--R--A--M--D--G--F--V--S--A--E--P--D--G--A--T--Y--V--F--Q--G--F--I--Q-

------------------------------------------><--------------------------------------------------------
-G--K--D--Y--G--Q--F--G--L--Q--R--L--G--L--N--M--S--E--G--S--N--S--S--N--Q--P--H--G--T--N--S--S--S--
GGCAAAGATTATGGACAATTTGGCCTACAAAGACTGGGACTGAATATGTCAGAAGGTTCAAATTCTTCAAATCAACCTCATGGTACAAATAGTAGTTCTG
::::::::::::::.:::::::: ::::::::::::   :::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GGCAAAGATTATGGGCAATTTGGACTACAAAGACTG---CTGAATATGTCAGAAGGTTCAAATTCTTCAAATCAACCTCATGGTACAAATAGTAGTTCTG
-G--K--D--Y--G--Q--F--G--L--Q--R--L-----L--N--M--S--E--G--S--N--S--S--N--Q--P--H--G--T--N--S--S--S--

------------------------------------------------------------------------------><--------------------
V--A--I--A--I--L--V--P--F--F--A--L--I--F--A--G--F--G--F--Y--L--Y--K--Q--R--T--A--P--K--T--Q--Y--T--G
TAGCCATTGCTATTCTTGTGCCTTTTTTTGCACTTATATTTGCAGGATTTGGATTTTATCTTTATAAACAAAGGACTGCACCTAAAACACAGTATACAGG
:.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::               ::::::::.:::::::::::::::::
TGGCCATTGCTATTCTTGTGCCTTTTTTTGCACTTATATTTGCAGGATTTGGATTTTAT---------------ACTGCACCCAAAACACAGTATACAGG
V--A--I--A--I--L--V--P--F--F--A--L--I--F--A--G--F--G--F--Y-----------------T--A--P--K--T--Q--Y--T--G

----------------------------------------------------------------------------------------------------
--C--S--V--H--E--N--N--N--G--Q--A--A--F--E--N--P--M--Y--D--T--N--A--K--S--V--E--G--K--A--V--R--F--D-
ATGTTCAGTTCATGAAAATAACAATGGCCAAGCAGCTTTTGAAAATCCCATGTATGACACCAACGCAAAGTCAGTGGAAGGGAAGGCGGTACGATTTGAT
:::::::::::::::::::::::::::::::::::: ::::::::.:::::::::::::::::.:::::::::::::::::::::::.::.:::::.:::
ATGTTCAGTTCATGAAAATAACAATGGCCAAGCAGCATTTGAAAACCCCATGTATGACACCAATGCAAAGTCAGTGGAAGGGAAGGCAGTGCGATTCGAT
--C--S--V--H--E--N--N--N--G--Q--A--A--F--E--N--P--M--Y--D--T--N--A--K--S--V--E--G--K--A--V--R--F--D-

---------------------------------
-P--N--L--N--T--V--C--T--M--V--*-
CCCAACTTGAACACGGTTTGCACAATGGTATAA
:::::::::::::::::.:::::::::::::::
CCCAACTTGAACACGGTCTGCACAATGGTATAA
-P--N--L--N--T--V--C--T--M--V--*-

Pig Consensus Sequence

>BGISUST0000878135
ATGAAAGGGATCCGCAAAGGGGAAAGCCGAGTGAAGGAATCCAAACCCCGGGAGCCTGGCAAGAGAAAATGCGCTAAATGTGGCCGCCTAGACTTCCTCC
TGATGAAGAAAATGGGGATTAAAAGTGGATTTACGTTTTGGAACCTCGTCTTTTTATTGACGGTGTCTTGTGTGAAA-----------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--TTAACAGGATTCCATCTGCCACCACCAGTGACAAGTACCAAATCTGTGTTCTCACTACGTTTGACCAGTGATTTTGCAGTTAGTGCTCATGGATTTAA
AGTATATTATGAA---CTGCAGAGTAGCTCTTGTGGAAATCCAGGAGTTCCACCTAAAGGGGTATTGTATGGTACAAGGTTCGATGTTGGAGACAAGATC
CGATACAGCTGTGTAACTGGATATATC-------------------------------------------------------------------------
-----------GAAGATGCATGTGGAGGAACAATGAGAGGATCTAGTGGCATCATATCAAGCCCTAGTTTTCCTAATGAGTACCATAATAATGCTGATTG
CACTTGGACCATTGTAGCAGAGCCTGGAGACACAATTTCACTCATATTTACTGATTTCCAAATGGAAGAAAAGTATGATTACTTAGAAATAGAAGGTTCT
GAGCCACCTACAATA---TTATCTGGAATGAATATACCACCACCAATTATCAGCAACAAAAACTGGCTCAGACTGCATTTTGTTACAGACAGCAATCACC
GATATCGTGGATTTAGTGCTCCTTATCAA---TCTTCTACATTGACCCACACTACCTCCACTGGTGAGTTAGAGGAGCATAACAGGACTACCACTGGTGC
TATTGCTGTTGCTAGCACATCTGCAGATGTTACTGTATCCAGTGTTACAGCTGTCACCATCCATAGACTTTCCGAGGAGCAGCGAGTGCAAGTAAAGAAT
CTCAGAAATTCAGGTCTGGACCCCAACACATCCAAGGACGGGCTTGCTCCTCATCAAGCAGATACACAAAGTACAAGGAGAAGACCAAGAAATGCTGAAC
AGATAGAAAGAACTAAAGAGCTTGCAGTTGTTACTCATAGA---AAAAAGGCCATAGATTTTAAATCTAGAGGATTTAAATTGTTTCCAGGGAAAGACAA
CAGCAACAAGTTTTCTATC---AATGAAGGAGGTATTAAGACAGCTTCCAATTTATGCCCAGATCCAGGAGAACCAGAAAATGGGAAGAGAGTTGGATCA
GATTTT---CTTGGATCAACTGTGCAGTTCTCTTGTGATGAAGATTATGTCCTACAGGGTGCTAAGAGCATCACCTGTCAACGGATAGCTGAAGTCTTTG
CTGCTTGGAGTGATCACAGGCCAGTATGTAAA--------------------------------------------------------------------
-------------------------------------------------------GTTATCCAGATAAATTTTGAAGAATTTGATCTGGAGATTGGCTAC
GATACCTTGACAATTGGTGATGGAGGTCAAGTTGGAGACCCAAGGACTGTGCTCCAA---CTTACTGGAAGCTTTGTCCCAGACTTAATAGTGAGCATGA
GTAGCCAAATGTGGCTTCACCTTCAAACAGATGAAAGTGTTGGATCTGTTGGCTTCAAGGTtaACTATAAA---ATTGAAAAAGAAAGTTGTGGTGATCC
TGGTACACCCTTATATGGAATTAGAGAAGGTGATGGATTTTCTAATCGTGATGTTTTAAGGTTTGAATGCCAGTTTGGATTTGAATTAATTGGAGAGAAA
TCCATTGTTTGTCAAGAGAATAACCAGTGGTCTGCAAACATACCCATCTGTATC----------------------------------------------
--------------GAAGGGTATGGAAATAATTTatGCATCTGGACAATAATCTCTGATCGCAGGAGTCGGATACACCTTTCCTTCAATGACTTTGATCT
GGAATCCCAGTTTGACTTCCTTGCTGTTAAAGATGGGGATTCTCCAGACTCCCCAATTCTTGGAACATTTACTGGGGCTGAGGTGCCTTCTCATCTTACT
AGTAACAGTCATATACTACGATTGGAATTTCAAGCTGATCACTCGATGTCAGGACGTGGCTTTAACATCACTTATAAC----------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---GTTACAGTGAACACCTATTCTTGCTTGGACCCTGGTATACCTGTACATGGTCGTCGCTATGGTCATGATTTCTCCATTGGATCTACTGTTTCATTTA
GTTGTGATCCAGGATACAGGCTAAGCCATGAAGAGCCTCTTTTATGTGAGAAAAACCACTGGTGGAGTCATCCACTTCCAACCTGTGAT---TTATGTGG
AGGAGATGTTAGAGGGCCTAGTGGCACAATTTTATCACCTGGTTACCCAGAATTTTATCCAAATTCTCTGAATTGTACGTGGACTGTTGATGTAACCCAT
GGAAAA----------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------TATAACCTGGAACCTTGCAAAGATCCTGGAATTCCTCAATTTGGAAACCGAATTGGGTTCAGCTTTGGAGTTGGT
GACACTCTGACCTTCTCATGCTCATCAGGTTATCGTCTGGAAGGGACGTCAGAGATCATCTGTCTTGGTGGTGGCCGACGAGTGTGGAGTGCACCTCTGC
CAAGGTGTGTG---GAATGTGGTGCATCTGCAACAAATAATGAAGGGATTTAGCTCTCTCCAAATTATCCACTCAACTATAAAAACAACCATGAATGCAT
TTATAGTATTCAGGTTCAAGCAGGAAAGGGAATCAATATTTCAGCCAGAACATTTCATTTAGCACAAGGAGATGTTCTTAAGATTTATGATGGAAAAGAC
AAAACAACTCATCTACTAGGTGCTTTTACTGGTGCATCTATGAGAGGACTGACACTTAGTAGTACTTCAAACCAGCTCTGGCTAGAATTTAATTCTGATT
CTGAAGGGACCGATGAAGGCTTTCAACTTGTCTATACC--------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------GAATGTGGAGGTCGTTTTAAAGGAGAATCATCAGGAAGAATCTTATCTCCTGGTTATCCCTTTCCAT
ATGACNATAATCTGCGTTGCATGTGGGTGATTGAGGTTGATCCAGGAAACATTGTC---CTACAGTTTCTTGCTTTTGATACGGAAGCATCACATGATAT
ACTCCGAGTTTGGGATGGTCCACCAGAAAATGAGATGCTTTTAAAGGAAATTAGTGGATCTCTCATTCCTGAAGGAATCCACAGCACCCTCAACATAGTC
ACCATACAGTTTGACACGGATTTCTATATCAGCAAATCTGGATTTGCAATTCAGTTTTCA----------------------------------------
----------------------------------------------------------------------------------------------------
-------------------------------------------------------CCCTGTGGAGGCAACTTGACACAGGATCTTCAGGCATTTATTCTT
TCCCCAAACTTTCCTCATCCGTATCCCCACAGCAGGGATTGTGACTGG---------------------------------------------TTTAGCA
TAGAACCAAACTATGACTTCCTCTATATATATGATGGACCAGACAGTAATAGCCCACTAATTGGAAGTTTTCAAGACAGCAAGTTACCAGAGAGAATAGA
AAGCAGCTCAAACACCATGCATTCGGCTTTTCGGAGTGATGGATCTGTTAGTTACACTGGATTTCATTTAGAATATAAA---------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------GTGTTT
GGCCAGTTTGTATTTTTCCAGACATCACTCCACGATGTTGTTGAGGTGTATGATGGGCCAACTCAGCAATCTTCTCTGTTATCTTCCCTCTCAGGATCCC
ATTCA-----------------------------------------------------------------------------------------------
-------------------------------------------GAACCAAGGTTTGGAAGAAGGATTGGCAATGAATTTGCAGTTGGTTCATTGGTTCTT
TTTGAATGTAATCCAGGATATATCCTCCATGGATCCATTGCAATTAGGTGTGATACAGTGCCGAATTCTTTGGCCCAGTGGAATGATTCCTTACCTACCT
GTATT-----------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------------ACAACAATACCCCATCTTTTGAATAGTACCTCTAATAATCTATATCTAAATTTTCAATCAGACATCAGTG
TTTCTGCTGCAGGATTTCACCTTGAATACACA---ATTGGTCTGGATTCCTGTCCTGAACCACAAACTCCTAGCAGTGGAATTAAAATTGGAGACAGATA
CATGGTTGGTGATGTAGTATCCTTTCAGTGTGATCAAGGCTATTCTCTTCAGGGTCATTCTCATATTACATGTATGCCAGGACCTGTCAGAAGATGGAAT
TACCCAATCCCAATTTGT------------------------------------------------------GGGTTTCCTGGAAACTACCCCAGCAGTT
TAGATTGCACGTGGACAATACAGCTGCCTGTGGGTTTT---GTACATCTGCAGTTTGTAAATTTTTCTACAGAAACCATACATGATTATTTGGAAGTAAG
AAGTGGATCCTCAGAAACTAGTACTGTTATTGGCCGACTTAGTGGTCCTCAAATACCGTCTTCTCTATTTAGCACAACCCATGAAACCAGCTTGTATTTT
CACAGTGACTATTCACAA----------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------GATGGACCAGACCAAAACTCACCACAGATTGGGCAATTCAGTGGCAATACTGCTTTGGAATCAGTGTACAGCACTTCAAATCA
GATTCTAATCAAATTTCACAGTGATTTCACGACAAGTGGCTTTTTCGTGCTCAGT---------TATCAACTCAGAGTGTGTCAACCTCCACCACCCGTA
CCCAATGCTGAAATTTTGACGGAAGATGATGAATTTGAAATA---GATATTATTAGGTATCAGTGTCTTCCAGGATTTACTTTGGTTGGTAATGCGATTC
TGACATGCAGATTAGGAGAAAGACTCCAGATGGATGGAGCACCTCCAGTTTGTCAA---CTCTGTCCTGCCAATGAATTACGCCTGGATTCTACAGGAGT
CATATTGAGCCCTGGATATCCTGACAGTTACCCAAATCTTCAGATGTGTGCTTGGAGTATATCTGTGGAAAAAGGATACCACATCAGCATGTTTGTAGAG
TTCTTCCAGACAGAAAAGGAATTTGATGTTCTTCAGGTGTATGAT-------------------------------------------------------
--------ATAACAAGCAATGGTCATGAAGTATTTCTTCAATGGTCAGCAGATCATGGTAATAACAAAAAAGGCTTCCGGATAAGATATATA---TTCTA
TTGTAGTACACCCGAATCACCACCTCATGGATATATTATCAGTCAGACAGGTGGACAGCTTAATAGTGTGGTCCGCTGGGCCTGTGATCGAGGATTCCGA
CTTGTTGGGAAGAGCAGCGCTGTGTGCAGAAAATCTTCCTATGGATATCACGCATGGGATGCACCGGTCCCTGCTTGT------ATTTCCTGTGGGATTC
CTAAAGCTCCAACAAATGGAGGAATACTCACAACAGACTACTTGGTAGGAACCCGAGTTACCTATTTTTGTAATGATGGATATAGATTGTCATCTAAGGA
GCTTACCACTGCCGTATGTCAATCA---------------------------------------------GTTACATGTCCAAGCATCAACTCCTTTACT
TTGGAACATGGAAGGTGGAGAATTGTGAATGGCTCCCATTATGAATACAAAACCAAGGTAGTTTTCAGCTGTGACCCTGGTTATCATGGACTAGGTCCTG
CTTCAATTGAGTGTCTTCCTAATGGTACCTGGAGTTGGAGAAATGAAAGACCATATTGCCAA--------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------GGTCACTGTGGAGTTCCAGAGCTTATTGTTAATGGTCAAGTCATTGGAGAAAATTATGGAT
ACAGAGACACTGTTGTTTACCAATGTAATCCTGGTTTTCGACTGATTGGTTCTTCAGTGAGAATATGTCAACAGGATCACAACTGGTCTGGTCAACTTCC
ATCCTGTGTG---GTGAGCTGTGGTCATCCTGGAAGTCCAATTTATGGAAGGACAAGTGGAAATGGATTCAACTTCAATGATGTGGTAACATTCTCTTGC
AACACTGGGTATCTCATGCAAGGGCCAACAAAAGCACAGTGTCAGGCCAACAGACAGTGGAGCCATCCTCCACCAGTGTGCAAA---GTCAACTGTTCTG
ATCCTGGAATTCCAGCTAATTCCAAAAGAGAAAGTAAAATAGAACATGGAAACTTTACCTATGGCACTGTGGTATTCTATGACTGCAATCCTGGATATTT
CTTATTTGGATCTTCAGTTTTGATATGTCAACCAAATGGACAATGGGACAAACCTTTACCAGAATGTATC---ATTGACTGCGGACACCCTGGCGTTCCT
CCTAATGCAGTCCTGTCTGGTGAGAAGTATACCTTTGGGTCCACTGTTCACTATTCCTGCACAGGAAAGCGTACCCTTCTAGGCCAGTCATCAAGGACTT
GCCAATTAAATGGCCATTGGAGTGGATCACAACCTCATTGTTCA--------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------------------------A
GTTCAGTCATCTATTCCTGCATAGAATGATATATCCTTTCTGGACCTTCAGTTAGGCCGTGCACAGCCGATGGAACATGGTCTGGAACTTTGCCTAACTG
TACA---ATCAGTTGtaGACCAGGTATACCAGCCAATGGACTGAGATATGGAGATGATTATGTGGTTGGGCAgaATGTTTCTTATATGTGCCAGCCAGGC
TATACAATGGAATTGAATGGTTCGAGAATCAGGACTTGTACTACGAATGGCACATGGAGTGGAGTAATGCCAACTTGCAGA---------TGCCCAACTC
CTCCCCAGATCTCTAATGGAAGGTTGGAAGGAACAAATTTCGACTGGGGCTTTAGCATTAGCTACATCTGTTCTCCAGGCTATGAACTATCCTTTCCTGC
TGTTTTGACCTGTGTAGGAAATGGTACCTGGAGTGGGGAAGTACCACAGTGCTTA---AAGTTTTGTGGTGACCCTGGCATACCCGCCCAAGGGAAAAGA
GAAGGCAAAAGCTTTATATACCAATCAGAGGTTTCATTCAGCTGCAACTCTCCTTTCATATTAGTGGGATCGAGCACTAGAATATGTCAAGCAGATGGCA
CTTGGAGTGGTTCATCACCTCACTGCATA-----------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------GCTCATGCAAATGTAGTAGGAATGGACCTCCCATCCCATGGGTATACATTAATAT
ATACCTGCCAGCCTGGCTTCTTCTTAGCAGGTGGAACAGAACATAGAGTGTGTAGATCTGATAACACCTGGACTGGAAAAGTTCCTGTTTGTGAA-----
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------GTATACAAAAGCCAAGAAGCTCGCCTAATGTTACACATTTATCTTATTAAAGTACCAGCTCATGCTTCTGTAAAGAA
AATGAAGGAGGAAAATCGGGCCATGGATGGCTTTGTTTCTGCTGAACCTGATGGAGCTACTTATGTATTTCAAGGATTTATCCAGGGCAAAGATTATGGG
CAATTTGGACTACAAAGACTG---CTGAATATGTCAGAAGGTTCAAATTCTTCAAATCAACCTCATGGTACAAATAGTAGTTCTGTGGCCATTGCTATTC
TTGTGCCTTTTTTTGCACTTATATTTGCAGGATTTGGATTTTAT---------------ACTGCACCCAAAACACAGTATACAGGATGTTCAGTTCATGA
AAATAACAATGGCCAAGCAGCATTTGAAAACCCCATGTATGACACCAATGCAAAGTCAGTGGAAGGGAAGGCAGTGCGATTCGATCCCAACTTGAACACG
GTCTGCACAATGGTATAA


>BGISUSP0000878135
MKGIRKGESRVKESKPREPGKRKCAKCGRLDFLLMKKMGIKSGFTFWNLVFLLTVSCVK-----------------------------------------
----------------------------------LTGFHLPPPVTSTKSVFSLRLTSDFAVSAHGFKVYYE-LQSSSCGNPGVPPKGVLYGTRFDVGDKI
RYSCVTGYI----------------------------EDACGGTMRGSSGIISSPSFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEIEGS
EPPTI-LSGMNIPPPIISNKNWLRLHFVTDSNHRYRGFSAPYQ-SSTLTHTTSTGELEEHNRTTTGAIAVASTSADVTVSSVTAVTIHRLSEEQRVQVKN
LRNSGLDPNTSKDGLAPHQADTQSTRRRPRNAEQIERTKELAVVTHR-KKAIDFKSRGFKLFPGKDNSNKFSI-NEGGIKTASNLCPDPGEPENGKRVGS
DF-LGSTVQFSCDEDYVLQGAKSITCQRIAEVFAAWSDHRPVCK-----------------------------------------VIQINFEEFDLEIGY
DTLTIGDGGQVGDPRTVLQ-LTGSFVPDLIVSMSSQMWLHLQTDESVGSVGFKVNYK-IEKESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFELIGEK
SIVCQENNQWSANIPICI--------------------EGYGNNLCIWTIISDRRSRIHLSFNDFDLESQFDFLAVKDGDSPDSPILGTFTGAEVPSHLT
SNSHILRLEFQADHSMSGRGFNITYN--------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-VTVNTYSCLDPGIPVHGRRYGHDFSIGSTVSFSCDPGYRLSHEEPLLCEKNHWWSHPLPTCD-LCGGDVRGPSGTILSPGYPEFYPNSLNCTWTVDVTH
GK-------------------------------------------------------------------------YNLEPCKDPGIPQFGNRIGFSFGVG
DTLTFSCSSGYRLEGTSEIICLGGGRRVWSAPLPRCV-ECGASATNNEGI*LSPNYPLNYKNNHECIYSIQVQAGKGINISARTFHLAQGDVLKIYDGKD
KTTHLLGAFTGASMRGLTLSSTSNQLWLEFNSDSEGTDEGFQLVYT------------------------------------------------------
-----------ECGGRFKGESSGRILSPGYPFPYD-NLRCMWVIEVDPGNIV-LQFLAFDTEASHDILRVWDGPPENEMLLKEISGSLIPEGIHSTLNIV
TIQFDTDFYISKSGFAIQFS-----------------------------------------------------------------PCGGNLTQDLQAFIL
SPNFPHPYPHSRDCDW---------------FSIEPNYDFLYIYDGPDSNSPLIGSFQDSKLPERIESSSNTMHSAFRSDGSVSYTGFHLEYK-------
--------------------------------------------------------------------------------------------------VF
GQFVFFQTSLHDVVEVYDGPTQQSSLLSSLSGSHS----------------------------------------------EPRFGRRIGNEFAVGSLVL
FECNPGYILHGSIAIRCDTVPNSLAQWNDSLPTCI-----------------------------------------------------------------
----------TTIPHLLNSTSNNLYLNFQSDISVSAAGFHLEYT-IGLDSCPEPQTPSSGIKIGDRYMVGDVVSFQCDQGYSLQGHSHITCMPGPVRRWN
YPIPIC------------------GFPGNYPSSLDCTWTIQLPVGF-VHLQFVNFSTETIHDYLEVRSGSSETSTVIGRLSGPQIPSSLFSTTHETSLYF
HSDYSQ----------------------------------------------------------------------------------------------
---------------------------------------DGPDQNSPQIGQFSGNTALESVYSTSNQILIKFHSDFTTSGFFVLS---YQLRVCQPPPPV
PNAEILTEDDEFEI-DIIRYQCLPGFTLVGNAILTCRLGERLQMDGAPPVCQ-LCPANELRLDSTGVILSPGYPDSYPNLQMCAWSISVEKGYHISMFVE
FFQTEKEFDVLQVYD---------------------ITSNGHEVFLQWSADHGNNKKGFRIRYI-FYCSTPESPPHGYIISQTGGQLNSVVRWACDRGFR
LVGKSSAVCRKSSYGYHAWDAPVPAC--ISCGIPKAPTNGGILTTDYLVGTRVTYFCNDGYRLSSKELTTAVCQS---------------VTCPSINSFT
LEHGRWRIVNGSHYEYKTKVVFSCDPGYHGLGPASIECLPNGTWSWRNERPYCQ----------------------------------------------
-------------GHCGVPELIVNGQVIGENYGYRDTVVYQCNPGFRLIGSSVRICQQDHNWSGQLPSCV-VSCGHPGSPIYGRTSGNGFNFNDVVTFSC
NTGYLMQGPTKAQCQANRQWSHPPPVCK-VNCSDPGIPANSKRESKIEHGNFTYGTVVFYDCNPGYFLFGSSVLICQPNGQWDKPLPECI-IDCGHPGVP
PNAVLSGEKYTFGSTVHYSCTGKRTLLGQSSRTCQLNGHWSGSQPHCS----------------------------------------------------
---------------------------------SSVIYSCIE*YILSGPSVRPCTADGTWSGTLPNCT-ISCRPGIPANGLRYGDDYVVGQNVSYMCQPG
YTMELNGSRIRTCTTNGTWSGVMPTCR---CPTPPQISNGRLEGTNFDWGFSISYICSPGYELSFPAVLTCVGNGTWSGEVPQCL-KFCGDPGIPAQGKR
EGKSFIYQSEVSFSCNSPFILVGSSTRICQADGTWSGSSPHCI---------------------------------------------------------
---------------AHANVVGMDLPSHGYTLIYTCQPGFFLAGGTEHRVCRSDNTWTGKVPVCE-----------------------------------
-----------------------------------------VYKSQEARLMLHIYLIKVPAHASVKKMKEENRAMDGFVSAEPDGATYVFQGFIQGKDYG
QFGLQRL-LNMSEGSNSSNQPHGTNSSSVAIAILVPFFALIFAGFGFY-----TAPKTQYTGCSVHENNNGQAAFENPMYDTNAKSVEGKAVRFDPNLNT
VCTMV*