Sequences
EST Library Info
fat1Fatt
hlv1Heart, left ventricle
pgl1Pituitary gland
rec1Rectum
sag1Salivary gland
tes1Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000165650 (click for geneview)
Transcript ID ENST00000298474(link to ensembl)
Symbol PDZK8
Localtion Chromosome:10:119032598:119124927:-1 band: 10q26.11
Description PDZ domain containing 8 [Source:RefSeq_peptide;Acc:NP_776152]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--L--L--L--M--I--L--A--S--A--V--L--G--S--F--L--T--L--L--A--Q--F--F--L--L--Y--R--R--Q--P--E--P--
ATGGGGCTGCTGCTCATGATCCTGGCGTCGGCCGTGCTGGGTTCCTTCCTCACGCTCCTCGCCCAGTTCTTCCTGCTGTACCGCAGACAGCCCGAGCCGC
            ::::::::::::::.::: ::::::::::.::::::::::::::::::.:::::::..: ::::: :::::::.:::::::  :::::
------------CTCATGATCCTGGCATCGTCCGTGCTGGGCTCCTTCCTCACGCTCCTCACCCAGTTTCTGCTGCTTTACCGCAAACAGCCCTTGCCGC
-------------L--M--I--L--A--S--S--V--L--G--S--F--L--T--L--L--T--Q--F--L--L--L--Y--R--K--Q--P--L--P--

----------------------------------------------------------------------------------------------------
P--A--D--E--A--A--R--A--G--E--G--F--R--Y--I--K--P--V--P--G--L--L--L--R--E--Y--L--Y--G--G--G--R--D--E
CGGCGGACGAGGCCGCCCGCGCGGGCGAGGGCTTCCGCTACATCAAGCCAGTGCCGGGCCTGCTCCTAAGGGAGTACCTTTATGGCGGCGGCCGGGATGA
:. ::::::::::::::::::: : :::.::::::::::::::::::::.:::::::::::: .:::. ::::::::::::::::::::::: ::: :::
CACCGGACGAGGCCGCCCGCGCCGCCGAAGGCTTCCGCTACATCAAGCCGGTGCCGGGCCTGGCCCTGCGGGAGTACCTTTATGGCGGCGGCGGGGCTGA
P--P--D--E--A--A--R--A--A--E--G--F--R--Y--I--K--P--V--P--G--L--A--L--R--E--Y--L--Y--G--G--G--G--A--E

----------------------------------------------------------------------------------------------------
--E--P--S--G--A--A--P--E--G--G--A--T--P--T--A--A--P--E--T--P--A--P--P--T--R--E--T--C--Y--F--L--N--A-
GGAGCCCTCCGGAGCGGCCCCTGAGGGCGGCGCGACCCCCACCGCGGCCCCCGAGACCCCCGCCCCGCCGACGCGGGAGACTTGCTACTTCCTCAACGCC
::::::: :::: : : :::::::::::::::::::::: :::      ::::::::::::::::::::::::::::::::.::::::::::::::::::
GGAGCCCGCCGGCGGGTCCCCTGAGGGCGGCGCGACCCCGACC------CCCGAGACCCCCGCCCCGCCGACGCGGGAGACCTGCTACTTCCTCAACGCC
--E--P--A--G--G--S--P--E--G--G--A--T--P--T--------P--E--T--P--A--P--P--T--R--E--T--C--Y--F--L--N--A-

----------------------------------------------------------------------------------------------------
-T--I--L--F--L--F--R--E--L--R--D--T--A--L--T--R--R--W--V--T--K--K--I--K--V--E--F--E--E--L--L--Q--T--
ACCATCCTATTCCTGTTCCGGGAGTTGCGGGACACCGCGCTGACCCGCCGCTGGGTCACCAAGAAGATCAAGGTGGAGTTCGAGGAGCTGCTGCAGACCA
:::::.::.:::::::::::::::.:::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::
ACCATTCTGTTCCTGTTCCGGGAGCTGCGGGACACCGCGCTGGCCCGCCGCTGGGTCACCAAGAAGATCAAGGTGGAGTTCGAGGAGCTGCTGCAGACCA
-T--I--L--F--L--F--R--E--L--R--D--T--A--L--A--R--R--W--V--T--K--K--I--K--V--E--F--E--E--L--L--Q--T--

----------------------------------------------------------------------------------------------------
K--T--A--G--R--L--L--E--G--L--S--L--R--D--V--F--L--G--E--T--V--P--F--I--K--T--I--R--L--V--R--P--V--V
AGACGGCCGGGCGCCTGCTGGAGGGGCTGAGCCTGCGGGACGTGTTCCTGGGCGAGACGGTGCCCTTCATCAAGACCATCCGGCTCGTGCGGCCAGTCGT
:::::::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::::. : ::::: :: ::
AGACGGCCGGGCGCCTGCTGGAGGGGCTGAGCCTGCGGGACGTGTTCCTGGGCGAGACCGTGCCCTTCATCAAGACCATCCGGCTTCTCCGGCCCGTGGT
K--T--A--G--R--L--L--E--G--L--S--L--R--D--V--F--L--G--E--T--V--P--F--I--K--T--I--R--L--L--R--P--V--V

----------------------------------------------------------------------------------------------------
--P--S--A--T--G--E--P--D--G--P--E--G--E--A--L--P--A--A--C--P--E--E--L--A--F--E--A--E--V--E--Y--N--G-
GCCCTCGGCCACCGGGGAGCCCGATGGCCCTGAAGGGGAGGCGCTGCCCGCCGCCTGCCCCGAGGAGCTGGCCTTCGAGGCGGAGGTGGAGTACAACGGG
:::::::::::::::::::::::::::::: ::::::::::::::.::::::.::: :::::::::::::::.::.::::::::::::::::::.::::.
GCCCTCGGCCACCGGGGAGCCCGATGGCCCAGAAGGGGAGGCGCTACCCGCCACCTCCCCCGAGGAGCTGGCTTTTGAGGCGGAGGTGGAGTACGACGGA
--P--S--A--T--G--E--P--D--G--P--E--G--E--A--L--P--A--T--S--P--E--E--L--A--F--E--A--E--V--E--Y--D--G-

----------------------------------------------------------------------------------------------------
-G--F--H--L--A--I--D--V--D--L--V--F--G--K--S--A--Y--L--F--V--K--L--S--R--V--V--G--R--L--R--L--V--F--
GGCTTCCACCTGGCCATCGACGTGGACCTGGTCTTCGGCAAGTCCGCCTACTTGTTTGTCAAGCTGTCCCGCGTGGTGGGAAGGCTGCGCTTGGTCTTTA
:::::::::.:::::::::::::::::::::::::::::::::::::::::.::::.:::::::::::::: :::: :::.::::::::::: :::.:.:
GGCTTCCACTTGGCCATCGACGTGGACCTGGTCTTCGGCAAGTCCGCCTACCTGTTCGTCAAGCTGTCCCGGGTGGAGGGGAGGCTGCGCTTCGTCCTCA
-G--F--H--L--A--I--D--V--D--L--V--F--G--K--S--A--Y--L--F--V--K--L--S--R--V--E--G--R--L--R--F--V--L--

----------------------------------------------------------------------------------------------------
T--R--V--P--F--T--H--W--F--F--S--F--V--E--D--P--L--I--D--F--E--V--R--S--Q--F--E--G--R--P--M--P--Q--L
CGCGCGTGCCCTTCACCCACTGGTTCTTCTCCTTCGTGGAAGACCCGCTGATCGACTTCGAGGTGCGCTCCCAGTTTGAAGGGCGGCCCATGCCCCAGCT
: ::::::::::::::::::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::::.:::::::::::::::::::::::
CCCGCGTGCCCTTCACCCACTGGTTCTTCTCCTTCGTGGAGGACCCACTGATCGACTTCGAGGTGCGCTCCCAGTTCGAAGGGCGGCCCATGCCCCAGCT
T--R--V--P--F--T--H--W--F--F--S--F--V--E--D--P--L--I--D--F--E--V--R--S--Q--F--E--G--R--P--M--P--Q--L

-----------------------------------------------------------------------><---------------------------
--T--S--I--I--V--N--Q--L--K--K--I--I--K--R--K--H--T--L--P--N--Y--K--I--R--F--K--P--F--F--P--Y--Q--T-
CACCTCCATCATCGTCAACCAGCTCAAGAAGATCATCAAGCGCAAGCACACCCTACCGAATTACAAGATCAGGTTTAAGCCGTTTTTTCCATACCAGACC
::::::::::::::::::::::::::::::.:::::::::::::::::::: ::.::::.::::::::::   ::::::::.:::::.::::  :   : 
CACCTCCATCATCGTCAACCAGCTCAAGAAAATCATCAAGCGCAAGCACACGCTGCCGAGTTACAAGATC---TTTAAGCCATTTTTCCCATT-CCTTC-
--T--S--I--I--V--N--Q--L--K--K--I--I--K--R--K--H--T--L--P--S--Y--K--I-----F--K--P--F--F--P--Y--P--S-

----------------------------------------------------------------------------------------------------
-L--Q--G--F--E--E--D--E--E--H--I--H--I--Q--Q--W--A--L--T--E--G--R--L--K--V--T--L--L--E--C--S--R--L--
TTGCAAGGATTTGAAGAAGATGAAGAGCATATCCATATACAACAATGGGCACTTACTGAAGGCCGTCTTAAAGTTACGTTGTTAGAATGTAGCAGGTTAC
:::::::::::::::::::::::::::::::::::::::::::::.:::::::::: :::::::: :::::::::::. :::::            ::::
TTGCAAGGATTTGAAGAAGATGAAGAGCATATCCATATACAACAACGGGCACTTACAGAAGGCCGACTTAAAGTTACAGTGTTA------------TTAC
-L--Q--G--F--E--E--D--E--E--H--I--H--I--Q--Q--R--A--L--T--E--G--R--L--K--V--T--V--L--------------L--

><--------------------------------------------------------------------------------------------------
L--I--F--G--S--Y--D--R--E--A--N--V--H--C--T--L--E--L--S--S--S--V--W--E--E--K--Q--R--S--S--I--K--T--V
TCATTTTTGGATCCTATGACAGAGAGGCAAATGTTCATTGCACACTTGAGTTAAGCAGTAGTGTTTGGGAAGAAAAACAGAGGAGTTCTATTAAGACGGT
:.:::::::::::::::::.::::::::::::.:::::::::::::::::.:.::::::::::::::::::::::::::.::::::::::::::::::::
TTATTTTTGGATCCTATGATAGAGAGGCAAATATTCATTGCACACTTGAGCTGAGCAGTAGTGTTTGGGAAGAAAAACAAAGGAGTTCTATTAAGACGGT
L--I--F--G--S--Y--D--R--E--A--N--I--H--C--T--L--E--L--S--S--S--V--W--E--E--K--Q--R--S--S--I--K--T--V

---><-----------------------------------------------------------------------------------------------
--E--L--I--K--G--N--L--Q--S--V--G--L--T--L--R--L--V--Q--S--T--D--G--Y--A--G--H--V--I--I--E--T--V--A-
TGAATTAATAAAAGGAAATTTACAAAGTGTTGGACTTACACTTCGTCTTGTCCAGTCAACTGATGGGTATGCTGGGCACGTCATCATTGAAACTGTGGCT
::::::::::::.:::::::: :::::: ::::::::::::::: ::: :::: :::::::::..:::::::::::.:: :::: ::: : :. : :::.
TGAATTAATAAAGGGAAATTTCCAAAGTTTTGGACTTACACTTCCTCTGGTCCCGTCAACTGACAGGTATGCTGGGTACCTCATAATTTACATGGAGGCC
--E--L--I--K--G--N--F--Q--S--F--G--L--T--L--P--L--V--P--S--T--D--R--Y--A--G--Y--L--I--I--Y--M--E--A-

------------------------------------------------------------------><--------------------------------
-P--N--S--P--A--A--I--A--D--L--Q--R--G--D--R--L--I--A--I--G--G--V--K--I--T--S--T--L--Q--V--L--K--L--
CCAAACTCGCCTGCTGCAATTGCAGATCTTCAGCGGGGAGATCGACTTATCGCCATTGGAGGTGTGAAAATCACATCAACACTGCAAGTGTTGAAGCTTA
::::::::.::::::: :::::::::::::::: :.:::::..:::: ::. :.:::                                           
CCAAACTCACCTGCTGAAATTGCAGATCTTCAGAGAGGAGACTGACTGATTTCTATT-------------------------------------------
-P--N--S--P--A--E--I--A--D--L--Q--R--G--D--*--L--I--S--I--------------------------------------------

----------------------------------------------------------------------------------------------------
I--K--Q--A--G--D--R--V--L--V--Y--Y--E--R--P--V--G--Q--S--N--Q--G--A--V--L--Q--D--N--F--G--Q--L--E--E
TCAAGCAGGCTGGTGACCGAGTCCTGGTGTACTATGAAAGGCCTGTTGGCCAGAGTAATCAAGGTGCAGTGCTGCAAGATAACTTTGGCCAGTTGGAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--N--F--L--S--S--S--C--Q--S--G--Y--E--E--E--A--A--G--L--T--V--D--T--E--S--R--E--L--D--S--E--F--E--D-
AAACTTTTTGTCAAGCTCATGCCAATCGGGTTATGAAGAGGAAGCTGCCGGGTTGACAGTAGATACTGAAAGTAGAGAGCTGGATTCTGAATTTGAAGAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--A--S--D--V--R--A--Q--N--E--F--K--D--E--A--Q--S--L--S--H--S--P--K--R--V--P--T--T--L--S--I--K--P--
TTGGCAAGTGATGTCAGAGCACAAAATGAGTTCAAAGATGAGGCACAATCATTAAGTCATAGTCCCAAACGTGTTCCAACAACACTTTCTATTAAACCCC
                                    :::::::::::.::::::::::::::::::::::::.::::::::::::: :::.:::::::.:
------------------------------------GATGAGGCACAGTCATTAAGTCATAGTCCCAAACGTATTCCAACAACACT-TCTGTTAAACCTC
-------------------------------------D--E--A--Q--S--L--S--H--S--P--K--R--I--P--T--T--L--S--V--K--P--

----------------------------------------------------------------------------------------------------
L--G--A--I--S--P--V--L--N--R--K--L--A--V--G--S--H--P--L--P--P--K--I--Q--S--K--D--G--N--K--P--P--P--L
TTGGAGCTATATCACCAGTTTTAAACCGTAAATTAGCTGTAGGAAGTCACCCACTACCACCGAAAATTCAGTCCAAAGATGGAAATAAACCTCCACCCCT
:::::.:::::::::::::::::::::: ::::::::::: :::.:::::::. .::::::.::: ::: .:::::::: ::. :::::.:...: ::::
TTGGAACTATATCACCAGTTTTAAACCGGAAATTAGCTGTTGGAGGTCACCCGACACCACCAAAACTTCCATCCAAAGAAGGGCATAAATCCTTAGCCCT
L--G--T--I--S--P--V--L--N--R--K--L--A--V--G--G--H--P--T--P--P--K--L--P--S--K--E--G--H--K--S--L--A--L

----------------------------------------------------------------------------------------------------
--K--T--S--E--I--T--D--P--A--Q--V--S--K--P--T--Q--G--S--A--F--K--P--P--V--P--P--R--P--Q--A--K--V--P-
AAAAACTTCTGAGATAACAGACCCAGCACAAGTGTCAAAACCAACCCAAGGATCTGCTTTCAAACCACCTGTGCCACCACGACCACAAGCGAAAGTTCCT
.::: :::::::::::::::: :::::::::.:::::::::: :::::::::::..::::::::::::::::::::::::::::.::::. :::.:::::
GAAATCTTCTGAGATAACAGAACCAGCACAAATGTCAAAACCCACCCAAGGATCCACTTTCAAACCACCTGTGCCACCACGACCGCAAGTCAAAATTCCT
--K--S--S--E--I--T--E--P--A--Q--M--S--K--P--T--Q--G--S--T--F--K--P--P--V--P--P--R--P--Q--V--K--I--P-

----------------------------------------------------------------------------------------------------
-L--P--S--A--D--A--P--N--Q--A--E--P--D--V--L--V--E--K--P--E--K--V-----V--P--P--P--L--V--D--K--S--A--
TTGCCTTCCGCCGATGCTCCAAATCAGGCAGAACCAGATGTTCTCGTTGAAAAGCCAGAGAAGGTG---GTGCCACCTCCTCTTGTAGATAAATCTGCTG
::::::::.::.::..:.::::::::::::::::.::::.:::..::::::::.::::::::::::    ::::::: ::::::..:::::::.::::::
TTGCCTTCTGCTGACACCCCAAATCAGGCAGAACTAGATATTCCTGTTGAAAAACCAGAGAAGGTGACTTTGCCACCACCTCTTACAGATAAACCTGCTG
-L--P--S--A--D--T--P--N--Q--A--E--L--D--I--P--V--E--K--P--E--K--V--T--L--P--P--P--L--T--D--K--P--A--

----------------------------------------------------------------------------------------------------
E--K--Q--A--K--N--V--D--A--I--D--D--A--A--A--P--K--Q--F--L--A--K--Q--E--V--A--K--D--V--T--S--E--T--S
AAAAGCAAGCAAAAAATGTGGATGCCATAGACGATGCAGCTGCACCTAAGCAATTTTTAGCAAAGCAAGAAGTGGCCAAAGATGTCACTTCAGAAACTTC
:::::::::..:::::: :::::  :.:.:: :: :: .::::  ::::.::.::::::::::::::.:::::::: :::::: : :::::::::: :::
AAAAGCAAGTGAAAAATCTGGATCACGTGGAAGAAGCCACTGCCGCTAAACAGTTTTTAGCAAAGCAGGAAGTGGCAAAAGATTTGACTTCAGAAAGTTC
E--K--Q--V--K--N--L--D--H--V--E--E--A--T--A--A--K--Q--F--L--A--K--Q--E--V--A--K--D--L--T--S--E--S--S

----------------------------------------------------------------------------------------------------
--C--P--T--K--D--S--S--D--D--R--Q--T--W--E--S--S--E--I--L--Y--R--N--K--L--G--K--W--T--R--T--R--A--S-
CTGCCCTACTAAGGACAGTTCGGACGACCGTCAAACATGGGAATCATCAGAAATTCTTTATCGTAATAAGCTAGGAAAATGGACAAGAACCAGAGCATCC
.:::::: ::::::::::.::.::.:::: ::::::.:::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::   :
TTGCCCTCCTAAGGACAGCTCAGATGACCCTCAAACGTGGGAATCATCAGAAATTCCTTATCGTAATAAGCTAGGAAAATGGACAAGAACCAGAGCTAGC
--C--P--P--K--D--S--S--D--D--P--Q--T--W--E--S--S--E--I--P--Y--R--N--K--L--G--K--W--T--R--T--R--A--S-

----------------------------------------------------------------------------------------------------
-C--L--F--D--I--E--A--C--H--R--Y--L--N--I--A--L--W--C--R--D--P--F--K--L--G--G--L--I--C--L--G--H--V--
TGTTTGTTTGACATAGAAGCCTGTCACAGGTACTTAAACATTGCATTGTGGTGCAGGGATCCTTTCAAGTTGGGAGGTCTCATCTGTTTGGGGCATGTTA
::::. :::::::::::::::::.:::::::::::::::::::::.::::::::::::::::::::::.::.::.:::::::::::.:::::::::::::
TGTTCTTTTGACATAGAAGCCTGCCACAGGTACTTAAACATTGCACTGTGGTGCAGGGATCCTTTCAAATTAGGGGGTCTCATCTGCTTGGGGCATGTTA
-C--S--F--D--I--E--A--C--H--R--Y--L--N--I--A--L--W--C--R--D--P--F--K--L--G--G--L--I--C--L--G--H--V--

----------------------------------------------------------------------------------------------------
S--L--K--L--E--D--V--A--L--G--C--L--A--T--S--N--T--E--Y--L--S--K--L--R--L--E--A--P--S--P--K--A--I--V
GTTTAAAACTTGAAGATGTGGCTTTAGGATGCCTAGCTACATCAAACACGGAATACCTTTCCAAATTGAGACTGGAAGCCCCCTCACCTAAGGCTATAGT
::::.::::::::::: ::::::::.::::::.::::.::::::::::.:::::::::::::::::: :::::::::::::: :::::::::::.::.::
GTTTGAAACTTGAAGAGGTGGCTTTGGGATGCTTAGCCACATCAAACATGGAATACCTTTCCAAATTCAGACTGGAAGCCCCATCACCTAAGGCCATGGT
S--L--K--L--E--E--V--A--L--G--C--L--A--T--S--N--M--E--Y--L--S--K--F--R--L--E--A--P--S--P--K--A--M--V

----------------------------------------------------------------------------------------------------
--T--R--T--A--L--R--N--L--S--M--Q--K--G--F--N--D--K--F--C--Y--G--D--I--T--I--H--F--K--Y--L--K--E--G-
CACTAGAACCGCACTACGCAATCTGAGTATGCAAAAGGGATTCAATGACAAATTTTGCTATGGTGACATTACTATTCACTTCAAATATTTGAAAGAAGGA
::: :::::::: ::::::::.::::::.:.::::::::::::::::::: :::::::: .:: ::.::::::.::::::::::.:::::::::::::::
CACAAGAACCGCTCTACGCAACCTGAGTGTACAAAAGGGATTCAATGACACATTTTGCTTCGGGGATATTACTGTTCACTTCAAGTATTTGAAAGAAGGA
--T--R--T--A--L--R--N--L--S--V--Q--K--G--F--N--D--T--F--C--F--G--D--I--T--V--H--F--K--Y--L--K--E--G-

----------------------------------------------------------------------------------------------------
-E--S--D--H--H--V--V--T--N--V--E--K--E--K--E--P--H--L--V--E--E--V--S--V--L--P--K--E--E--Q--F--V--G--
GAATCAGACCACCATGTAGTTACTAACGTAGAAAAAGAAAAAGAACCCCATTTGGTTGAAGAAGTTTCTGTTCTCCCTAAAGAGGAGCAATTTGTTGGAC
::..:::: :::::::::::::::::: ::::.:::::::::::::.:::::::::.:::::.:::::::..::  ::::::::::::: ::::::::::
GAGCCAGAGCACCATGTAGTTACTAACTTAGAGAAAGAAAAAGAACTCCATTTGGTCGAAGAGGTTTCTGCCCTGACTAAAGAGGAGCACTTTGTTGGAC
-E--P--E--H--H--V--V--T--N--L--E--K--E--K--E--L--H--L--V--E--E--V--S--A--L--T--K--E--E--H--F--V--G--

----------------------------------------------------------------------------------------------------
Q--M--G--L--T--E--N--K--H--S--F--Q--D--T--Q--F--Q--N--P--T--W--C--D--Y--C--K--K--K--V--W--T--K--A--A
AGATGGGTTTAACAGAAAACAAACACAGTTTTCAGGATACTCAGTTCCAGAACCCAACATGGTGTGACTACTGTAAGAAAAAAGTTTGGACTAAAGCAGC
:::.::::::.::::::::.::.::.:::::.::.::::::::::::::::::::::: ::::::::.:::::::::::.::::::::::::::::: ::
AGACGGGTTTGACAGAAAATAAGCATAGTTTCCAAGATACTCAGTTCCAGAACCCAACTTGGTGTGATTACTGTAAGAAGAAAGTTTGGACTAAAGCTGC
Q--T--G--L--T--E--N--K--H--S--F--Q--D--T--Q--F--Q--N--P--T--W--C--D--Y--C--K--K--K--V--W--T--K--A--A

----------------------------------------------------------------------------------------------------
--S--Q--C--M--F--C--A--Y--V--C--H--K--K--C--Q--E--K--C--L--A--E--T--S--V--C--G--A--T--D--R--R--I--D-
TTCCCAGTGTATGTTTTGTGCTTATGTTTGCCATAAAAAATGTCAAGAAAAGTGTCTAGCTGAGACTTCTGTTTGTGGAGCAACTGATAGGCGAATAGAC
.::::::::::::::.:::::::::::::::::::::::::::::.::::::::::::::.::::::.:: ::::::::::::::::. .:::.::::::
CTCCCAGTGTATGTTCTGTGCTTATGTTTGCCATAAAAAATGTCAGGAAAAGTGTCTAGCCGAGACTCCTCTTTGTGGAGCAACTGACCAGCGGATAGAC
--S--Q--C--M--F--C--A--Y--V--C--H--K--K--C--Q--E--K--C--L--A--E--T--P--L--C--G--A--T--D--Q--R--I--D-

----------------------------------------------------------------------------------------------------
-R--T--L--K--N--L--R--L--E--G--Q--E--T--L--L--G--L--P--P--R--V--D--A--E--A--S--K--S--V--N--K--T--T--
AGGACACTGAAAAACCTTAGGCTGGAAGGACAGGAAACCCTCTTAGGCCTGCCTCCTCGTGTTGATGCTGAAGCTAGCAAGTCAGTCAATAAAACAACAG
::..: :::::::::::.::::::::::::::.::::::::::::::.:::::.:::::::::::::::::::::.:::::::::::::.:.::::::::
AGAGCCCTGAAAAACCTCAGGCTGGAAGGACAAGAAACCCTCTTAGGTCTGCCCCCTCGTGTTGATGCTGAAGCTGGCAAGTCAGTCAACAGAACAACAG
-R--A--L--K--N--L--R--L--E--G--Q--E--T--L--L--G--L--P--P--R--V--D--A--E--A--G--K--S--V--N--R--T--T--

----------------------------------------------------------------------------------------------------
G--L--T--R--H--I--I--N--T--S--S--R--L--L--N--L--R--Q--V--S--K--T--R--L--S--E--P--G--T--D--L--V--E--P
GTTTGACAAGGCATATTATCAATACTAGTTCTCGTTTATTAAATTTGCGTCAAGTCTCTAAAACTCGCCTTTCTGAACCAGGAACCGATCTCGTAGAACC
::::::::::.:::::::::::::: ::.::::::::.::::::.:::::::::::::::::::::::::::::::.::::::::.::::: ::::::::
GTTTGACAAGACATATTATCAATACAAGCTCTCGTTTGTTAAATCTGCGTCAAGTCTCTAAAACTCGCCTTTCTGAGCCAGGAACTGATCTAGTAGAACC
G--L--T--R--H--I--I--N--T--S--S--R--L--L--N--L--R--Q--V--S--K--T--R--L--S--E--P--G--T--D--L--V--E--P

----------------------------------------------------------------------------------------------------
--S--P--K--H--T--P--N--T--S--D--N--E--G--S--D--T--E--V--C--G--P--N--S--P--S--K--R--G--N--S--T--G--I-
TTCACCAAAACACACACCCAACACGTCAGACAACGAAGGCAGTGACACGGAGGTCTGTGGTCCAAACAGTCCTTCTAAACGGGGAAACAGCACAGGAATA
::::::::::::::::::::::::.:::::::::::::::::.:::::.:::::::::::::::::::::::.:::::.::::: ::::.::::::::::
TTCACCAAAACACACACCCAACACATCAGACAACGAAGGCAGCGACACAGAGGTCTGTGGTCCAAACAGTCCCTCTAAGCGGGGCAACAACACAGGAATA
--S--P--K--H--T--P--N--T--S--D--N--E--G--S--D--T--E--V--C--G--P--N--S--P--S--K--R--G--N--N--T--G--I-

----------------------------------------------------------------------------------------------------
-K--L--V--R--K--E--G--G--L--D--D--S--V--F--I--A--V--K--E--I--G--R--D--L--Y--R--G--L--P--T--E--E--R--
AAGTTAGTGAGAAAAGAGGGTGGTCTGGATGACAGTGTTTTCATTGCAGTTAAAGAAATTGGTCGTGATCTGTACAGGGGCTTGCCTACAGAGGAAAGGA
::::::::::::::.:::::::::::::::::::::::::::::::: :::::::::::.:::::::::::::::::::::::::::::.:::::.::::
AAGTTAGTGAGAAAGGAGGGTGGTCTGGATGACAGTGTTTTCATTGCTGTTAAAGAAATCGGTCGTGATCTGTACAGGGGCTTGCCTACGGAGGAGAGGA
-K--L--V--R--K--E--G--G--L--D--D--S--V--F--I--A--V--K--E--I--G--R--D--L--Y--R--G--L--P--T--E--E--R--

----------------------------------------------------------------------------------------------------
I--Q--K--L--E--F--M--L--D--K--L--Q--N--E--I--D--Q--E--L--E--H--N--N--S--L--V--R--E--E--K--E--T--T--D
TCCAGAAACTAGAGTTCATGTTGGATAAGCTACAGAATGAAATTGATCAGGAGTTGGAACACAATAATTCCCTTGTTAGAGAAGAAAAAGAGACAACTGA
::::::::::::::::::::.:.:::::.::.:::::::::::::::::::::::::::::.::.:::::::::::::::::::::::::::::::::::
TCCAGAAACTAGAGTTCATGCTAGATAAACTGCAGAATGAAATTGATCAGGAGTTGGAACATAACAATTCCCTTGTTAGAGAAGAAAAAGAGACAACTGA
I--Q--K--L--E--F--M--L--D--K--L--Q--N--E--I--D--Q--E--L--E--H--N--N--S--L--V--R--E--E--K--E--T--T--D

----------------------------------------------------------------------------------------------------
--T--R--K--K--S--L--L--S--A--A--L--A--K--S--G--E--R--L--Q--A--L--T--L--L--M--I--H--Y--R--A--G--I--E-
TACAAGGAAAAAATCACTTCTTTCTGCTGCCTTAGCTAAATCAGGTGAAAGGCTACAAGCTCTAACACTTCTTATGATTCACTACAGAGCAGGCATTGAA
: :.:::::::::::: :::::::::: ::.::.:::::::::::::::::.::.:::::::::::::::::.:::::.:::::.:::::::::::::::
TTCGAGGAAAAAATCAATTCTTTCTGCGGCTTTGGCTAAATCAGGTGAAAGACTGCAAGCTCTAACACTTCTCATGATCCACTATAGAGCAGGCATTGAA
--S--R--K--K--S--I--L--S--A--A--L--A--K--S--G--E--R--L--Q--A--L--T--L--L--M--I--H--Y--R--A--G--I--E-

----------------------------------------------------------------------------------------------------
-D--I--E--T--L--E--S--L--S--L--D--Q--H--S--K--K--I--S--K--Y--T--D--D--T--E--E--D--L--D--N--E--I--S--
GATATAGAAACTTTAGAAAGTCTGTCTTTAGACCAGCACTCCAAAAAAATAAGCAAGTACACAGATGATACAGAAGAAGACCTTGATAATGAAATAAGCC
:::.: ::: ::::::::::::: :::.::::.::::::::::::::::::::::::::.::::::::::::::::::::::: ::::::::::::: ::
GATGTCGAATCTTTAGAAAGTCTCTCTCTAGATCAGCACTCCAAAAAAATAAGCAAGTATACAGATGATACAGAAGAAGACCTAGATAATGAAATAACCC
-D--V--E--S--L--E--S--L--S--L--D--Q--H--S--K--K--I--S--K--Y--T--D--D--T--E--E--D--L--D--N--E--I--T--

--------------------------------------------------------------------
Q--L--I--D--S--Q--P--F--S--S--I--S--D--D--L--F--G--P--S--E--S--V--*-
AACTAATAGACTCTCAGCCATTCAGCAGCATATCAGATGACTTATTTGGCCCATCCGAGTCTGTGTAG
:::::::::::::::::::::::::.::::::.::::::::::::::::::: ::.::::::::    
AACTAATAGACTCTCAGCCATTCAGTAGCATACCAGATGACTTATTTGGCCCTTCTGAGTCTGTT---
Q--L--I--D--S--Q--P--F--S--S--I--P--D--D--L--F--G--P--S--E--S--V----

Pig Consensus Sequence

>BGISUST0000889150
------------CTCATGATCCTGGCATCGTCCGTGCTGGGCTCCTTCCTCACGCTCCTCACCCAGTTTCTGCTGCTTTACCGCAAACAGCCCTTGCCGC
CACCGGACGAGGCCGCCCGCGCCGCCGAAGGCTTCCGCTACATCAAGCCGGTGCCGGGCCTGGCCCTGCGGGAGTACCTTTATGGCGGCGGCGGGGCTGA
GGAGCCCGCCGGCGGGTCCCCTGAGGGCGGCGCGACCCCGACCCCCGAGACCCCCGCCCCGCCGACGCGGGAGACCTGCTACTTCCTCAACGCCACCATT
CTGTTCCTGTTCCGGGAGCTGCGGGACACCGCGCTGGCCCGCCGCTGGGTCACCAAGAAGATCAAGGTGGAGTTCGAGGAGCTGCTGCAGACCAAGACGG
CCGGGCGCCTGCTGGAGGGGCTGAGCCTGCGGGACGTGTTCCTGGGCGAGACCGTGCCCTTCATCAAGACCATCCGGCTTCTCCGGCCCGTGGTGCCCTC
GGCCACCGGGGAGCCCGATGGCCCAGAAGGGGAGGCGCTACCCGCCACCTCCCCCGAGGAGCTGGCTTTTGAGGCGGAGGTGGAGTACGACGGAGGCTTC
CACTTGGCCATCGACGTGGACCTGGTCTTCGGCAAGTCCGCCTACCTGTTCGTCAAGCTGTCCCGGGTGGAGGGGAGGCTGCGCTTCGTCCTCACCCGCG
TGCCCTTCACCCACTGGTTCTTCTCCTTCGTGGAGGACCCACTGATCGACTTCGAGGTGCGCTCCCAGTTCGAAGGGCGGCCCATGCCCCAGCTCACCTC
CATCATCGTCAACCAGCTCAAGAAAATCATCAAGCGCAAGCACACGCTGCCGAGTTACAAGATC---TTTAAGCCATTTTTCCCacCttTGCAAGGATTT
GAAGAAGATGAAGAGCATATCCATATACAACAACGGGCACTTACAGAAGGCCGACTTAAAGTTACAGTGTTA------------TTACTTATTTTTGGAT
CCTATGATAGAGAGGCAAATATTCATTGCACACTTGAGCTGAGCAGTAGTGTTTGGGAAGAAAAACAAAGGAGTTCTATTAAGACGGTTGAATTAATAAA
GGGAAATTTCCAAAGTTTTGGACTTACACTTCCTCTGGTCCCGTCAACTGACAGGTATGCTGGGTACCTCATAATTTACATGGAGGCCCCAAACTCACCT
GCTGAAATTGCAGATCTTCAGAGAGGAGACTGACTGATTTCTATT-------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
------------------------GATGAGGCACAGTCATTAAGTCATAGTCCCAAACGTATTCCAACAACatCTGTTAAACCTCTTGGAACTATATCAC
CAGTTTTAAACCGGAAATTAGCTGTTGGAGGTCACCCGACACCACCAAAACTTCCATCCAAAGAAGGGCATAAATCCTTAGCCCTGAAATCTTCTGAGAT
AACAGAACCAGCACAAATGTCAAAACCCACCCAAGGATCCACTTTCAAACCACCTGTGCCACCACGACCGCAAGTCAAAATTCCTTTGCCTTCTGCTGAC
ACCCCAAATCAGGCAGAACTAGATATTCCTGTTGAAAAACCAGAGAAGGTGACTTTGCCACCACCTCTTACAGATAAACCTGCTGAAAAGCAAGTGAAAA
ATCTGGATCACGTGGAAGAAGCCACTGCCGCTAAACAGTTTTTAGCAAAGCAGGAAGTGGCAAAAGATTTGACTTCAGAAAGTTCTTGCCCTCCTAAGGA
CAGCTCAGATGACCCTCAAACGTGGGAATCATCAGAAATTCCTTATCGTAATAAGCTAGGAAAATGGACAAGAACCAGAGCTAGCTGTTCTTTTGACATA
GAAGCCTGCCACAGGTACTTAAACATTGCACTGTGGTGCAGGGATCCTTTCAAATTAGGGGGTCTCATCTGCTTGGGGCATGTTAGTTTGAAACTTGAAG
AGGTGGCTTTGGGATGCTTAGCCACATCAAACATGGAATACCTTTCCAAATTCAGACTGGAAGCCCCATCACCTAAGGCCATGGTCACAAGAACCGCTCT
ACGCAACCTGAGTGTACAAAAGGGATTCAATGACACATTTTGCTTCGGGGATATTACTGTTCACTTCAAGTATTTGAAAGAAGGAGAGCCAGAGCACCAT
GTAGTTACTAACTTAGAGAAAGAAAAAGAACTCCATTTGGTCGAAGAGGTTTCTGCCCTGACTAAAGAGGAGCACTTTGTTGGACAGACGGGTTTGACAG
AAAATAAGCATAGTTTCCAAGATACTCAGTTCCAGAACCCAACTTGGTGTGATTACTGTAAGAAGAAAGTTTGGACTAAAGCTGCCTCCCAGTGTATGTT
CTGTGCTTATGTTTGCCATAAAAAATGTCAGGAAAAGTGTCTAGCCGAGACTCCTCTTTGTGGAGCAACTGACCAGCGGATAGACAGAGCCCTGAAAAAC
CTCAGGCTGGAAGGACAAGAAACCCTCTTAGGTCTGCCCCCTCGTGTTGATGCTGAAGCTGGCAAGTCAGTCAACAGAACAACAGGTTTGACAAGACATA
TTATCAATACAAGCTCTCGTTTGTTAAATCTGCGTCAAGTCTCTAAAACTCGCCTTTCTGAGCCAGGAACTGATCTAGTAGAACCTTCACCAAAACACAC
ACCCAACACATCAGACAACGAAGGCAGCGACACAGAGGTCTGTGGTCCAAACAGTCCCTCTAAGCGGGGCAACAACACAGGAATAAAGTTAGTGAGAAAG
GAGGGTGGTCTGGATGACAGTGTTTTCATTGCTGTTAAAGAAATCGGTCGTGATCTGTACAGGGGCTTGCCTACGGAGGAGAGGATCCAGAAACTAGAGT
TCATGCTAGATAAACTGCAGAATGAAATTGATCAGGAGTTGGAACATAACAATTCCCTTGTTAGAGAAGAAAAAGAGACAACTGATTCGAGGAAAAAATC
AATTCTTTCTGCGGCTTTGGCTAAATCAGGTGAAAGACTGCAAGCTCTAACACTTCTCATGATCCACTATAGAGCAGGCATTGAAGATGTCGAATCTTTA
GAAAGTCTCTCTCTAGATCAGCACTCCAAAAAAATAAGCAAGTATACAGATGATACAGAAGAAGACCTAGATAATGAAATAACCCAACTAATAGACTCTC
AGCCATTCAGTAGCATACCAGATGACTTATTTGGCCCTTCTGAGTCT---


>BGISUSP0000889150
----LMILASSVLGSFLTLLTQFLLLYRKQPLPPPDEAARAAEGFRYIKPVPGLALREYLYGGGGAEEPAGGSPEGGATPTPETPAPPTRETCYFLNATI
LFLFRELRDTALARRWVTKKIKVEFEELLQTKTAGRLLEGLSLRDVFLGETVPFIKTIRLLRPVVPSATGEPDGPEGEALPATSPEELAFEAEVEYDGGF
HLAIDVDLVFGKSAYLFVKLSRVEGRLRFVLTRVPFTHWFFSFVEDPLIDFEVRSQFEGRPMPQLTSIIVNQLKKIIKRKHTLPSYKI-FKPFFPPLQGF
EEDEEHIHIQQRALTEGRLKVTVL----LLIFGSYDREANIHCTLELSSSVWEEKQRSSIKTVELIKGNFQSFGLTLPLVPSTDRYAGYLIIYMEAPNSP
AEIADLQRGD*LISI-------------------------------------------------------------------------------------
--------DEAQSLSHSPKRIPTTSVKPLGTISPVLNRKLAVGGHPTPPKLPSKEGHKSLALKSSEITEPAQMSKPTQGSTFKPPVPPRPQVKIPLPSAD
TPNQAELDIPVEKPEKVTLPPPLTDKPAEKQVKNLDHVEEATAAKQFLAKQEVAKDLTSESSCPPKDSSDDPQTWESSEIPYRNKLGKWTRTRASCSFDI
EACHRYLNIALWCRDPFKLGGLICLGHVSLKLEEVALGCLATSNMEYLSKFRLEAPSPKAMVTRTALRNLSVQKGFNDTFCFGDITVHFKYLKEGEPEHH
VVTNLEKEKELHLVEEVSALTKEEHFVGQTGLTENKHSFQDTQFQNPTWCDYCKKKVWTKAASQCMFCAYVCHKKCQEKCLAETPLCGATDQRIDRALKN
LRLEGQETLLGLPPRVDAEAGKSVNRTTGLTRHIINTSSRLLNLRQVSKTRLSEPGTDLVEPSPKHTPNTSDNEGSDTEVCGPNSPSKRGNNTGIKLVRK
EGGLDDSVFIAVKEIGRDLYRGLPTEERIQKLEFMLDKLQNEIDQELEHNNSLVREEKETTDSRKKSILSAALAKSGERLQALTLLMIHYRAGIEDVESL
ESLSLDQHSKKISKYTDDTEEDLDNEITQLIDSQPFSSIPDDLFGPSES-