Sequences
EST Library Info
che1Heart - RNA from China
cli3Liver - RNA from China
dbla1Unavailable
eru1Foetus 50 days, regio umbilicalis
fat3Fatt
jca1Joint capsule
lin1Large intestine
lnt4Lymphatic nodule tracheobroncalis
nca4Newborn 115 days, cartillage
nep1Newborn 115 days, epidermis
ova1Ovary
pgl1Pituitary gland
pldo1Unavailable
pliv2Unavailable
ret1Retina
sme2M. Semimembranosus
spl1Spleen
ssp1M. Supraspinatus
tra1Trachea
ute1Uterus
Clusters
Oligos
SNPs

Gene ID ENSG00000151923 (click for geneview)
Transcript ID ENST00000298518(link to ensembl)
Symbol TIAL1
Localtion Chromosome:10:121324925:121346531:-1 band: 10q26.11
Description Nucleolysin TIAR (TIA-1 related protein). [Source:Uniprot/SWISSPROT;Acc:Q01085]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<------------------------------><-------------------------------------------------------------------
-M--M--E--D--D--G--Q--P--R--T--L--Y--V--G--N--L--S--R--D--V--T--E--V--L--I--L--Q--L--F--S--Q--I--G--
ATGATGGAAGACGACGGGCAGCCCCGGACTCTATACGTAGGTAACCTTTCCAGAGATGTGACAGAAGTCCTTATACTTCAGTTGTTCAGTCAGATTGGAC
::::::::::::::::::::::::::::::   ::::::::::::::.:::::::::::.::::::::.::::: ::::::::.::::::::::::::::
ATGATGGAAGACGACGGGCAGCCCCGGACT---TACGTAGGTAACCTCTCCAGAGATGTAACAGAAGTTCTTATTCTTCAGTTATTCAGTCAGATTGGAC
-M--M--E--D--D--G--Q--P--R--T-----Y--V--G--N--L--S--R--D--V--T--E--V--L--I--L--Q--L--F--S--Q--I--G--

----------------------------><----------------------------------------------------------------------
P--C--K--S--C--K--M--I--T--E--H--T--S--N--D--P--Y--C--F--V--E--F--Y--E--H--R--D--A--A--A--A--L--A--A
CCTGTAAAAGCTGTAAAATGATAACAGAGCATACAAGCAATGACCCATATTGCTTTGTGGAATTTTATGAACACAGAGATGCAGCTGCTGCATTAGCTGC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCTGTAAAAGCTGTAAAATGATAACAGAGCATACAAGCAATGACCCATATTGCTTTGTGGAATTTTATGAACACAGAGATGCAGCTGCTGCATTAGCTGC
P--C--K--S--C--K--M--I--T--E--H--T--S--N--D--P--Y--C--F--V--E--F--Y--E--H--R--D--A--A--A--A--L--A--A

---------------------------><-----------------------------------------------------><----------------
--M--N--G--R--K--I--L--G--K--E--V--K--V--N--W--A--T--T--P--S--S--Q--K--K--D--T--S--N--H--F--H--V--F-
TATGAATGGGAGAAAAATTTTGGGAAAGGAGGTCAAAGTAAACTGGGCAACCACACCAAGTAGCCAGAAAAAAGATACTTCCAATCACTTCCATGTGTTT
:::::::::::::::::::::::::::::::::::.::::::::::::::: ::::::::::::::::::::::::::::::   ::.::::::::::::
TATGAATGGGAGAAAAATTTTGGGAAAGGAGGTCAGAGTAAACTGGGCAACAACACCAAGTAGCCAGAAAAAAGATACTTCC---CATTTCCATGTGTTT
--M--N--G--R--K--I--L--G--K--E--V--R--V--N--W--A--T--T--P--S--S--Q--K--K--D--T--S-----H--F--H--V--F-

----------------------------------------------------------------------><----------------------------
-V--G--D--L--S--P--E--I--T--T--E--D--I--K--S--A--F--A--P--F--G--K--I--S--D--A--R--V--V--K--D--M--A--
GTTGGGGATTTGAGTCCAGAAATTACAACAGAAGATATCAAATCAGCATTTGCCCCCTTTGGTAAAATATCGGATGCCCGGGTAGTTAAAGACATGGCAA
:::::::::::::::::::::::::::.::::::::::::::::::::::..::.::::::::::::::   ::::::::.:::::::::::.:::::::
GTTGGGGATTTGAGTCCAGAAATTACAGCAGAAGATATCAAATCAGCATTCACCTCCTTTGGTAAAATA---GATGCCCGAGTAGTTAAAGATATGGCAA
-V--G--D--L--S--P--E--I--T--A--E--D--I--K--S--A--F--T--S--F--G--K--I-----D--A--R--V--V--K--D--M--A--

----------------------------------------------><----------------------------------------------------
T--G--K--S--K--G--Y--G--F--V--S--F--Y--N--K--L--D--A--E--N--A--I--V--H--M--G--G--Q--W--L--G--G--R--Q
CTGGAAAATCCAAAGGCTATGGTTTTGTATCTTTTTATAACAAACTGGATGCAGAAAATGCGATTGTGCATATGGGCGGTCAGTGGTTGGGTGGTCGTCA
::::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::.:::::::::::::: :::::::::::::::::::::::
CTGGAAAATCTAAAGGCTATGGCTTTGTATCTTTTTATAACAAACTGGATGCAGAAAATGCAATTGTGCATATGGGAGGTCAGTGGTTGGGTGGTCGTCA
T--G--K--S--K--G--Y--G--F--V--S--F--Y--N--K--L--D--A--E--N--A--I--V--H--M--G--G--Q--W--L--G--G--R--Q

-------------------------------------------------------><-------------------------------------------
--I--R--T--N--W--A--T--R--K--P--P--A--P--K--S--T--Q--E--N--N--T--K--Q--L--R--F--E--D--V--V--N--Q--S-
AATCCGAACCAATTGGGCCACTCGTAAACCACCTGCACCTAAAAGTACACAAGAAAACAACACTAAGCAGTTGAGATTTGAAGATGTAGTAAACCAGTCA
:::: :::::::::::::::: :::::::::::::::::::::::::::::::::   ::::::::::::::::::::::::::::::::::::::::::
AATCAGAACCAATTGGGCCACACGTAAACCACCTGCACCTAAAAGTACACAAGAA---AACACTAAGCAGTTGAGATTTGAAGATGTAGTAAACCAGTCA
--I--R--T--N--W--A--T--R--K--P--P--A--P--K--S--T--Q--E-----N--T--K--Q--L--R--F--E--D--V--V--N--Q--S-

---------------------------------------------------><-----------------------------------------------
-S--P--K--N--C--T--V--Y--C--G--G--I--A--S--G--L--T--D--Q--L--M--R--Q--T--F--S--P--F--G--Q--I--M--E--
AGTCCAAAAAATTGTACTGTGTACTGTGGAGGAATTGCGTCTGGGTTAACAGATCAGCTTATGAGACAGACATTCTCACCATTTGGACAAATTATGGAAA
:::::::::::::::::::::::::::::::::::::: ::::::::::::   ::.:::::::::::.:::::.:::::::::::::::::::::::.:
AGTCCAAAAAATTGTACTGTGTACTGTGGAGGAATTGCTTCTGGGTTAACA---CAACTTATGAGACAAACATTTTCACCATTTGGACAAATTATGGAGA
-S--P--K--N--C--T--V--Y--C--G--G--I--A--S--G--L--T-----Q--L--M--R--Q--T--F--S--P--F--G--Q--I--M--E--

------------------------------------><--------------------------------------------------------------
I--R--V--F--P--E--K--G--Y--S--F--V--R--F--S--T--H--E--S--A--A--H--A--I--V--S--V--N--G--T--T--I--E--G
TAAGAGTTTTCCCAGAAAAGGGCTATTCATTTGTCAGATTTTCAACCCATGAAAGTGCAGCCCATGCCATTGTTTCGGTGAACGGTACTACGATTGAAGG
::::::::::.:::::.::::: :::::.::::::   ::::: :::::.:::::::::::::::::::::::.::.:::::.:::::::::::.:::::
TAAGAGTTTTTCCAGAGAAGGGGTATTCGTTTGTC---TTTTCCACCCACGAAAGTGCAGCCCATGCCATTGTCTCAGTGAATGGTACTACGATCGAAGG
I--R--V--F--P--E--K--G--Y--S--F--V-----F--S--T--H--E--S--A--A--H--A--I--V--S--V--N--G--T--T--I--E--G

------------------------------------------------------------><--------------------------------------
--H--V--V--K--C--Y--W--G--K--E--S--P--D--M--T--K--N--F--Q--Q--V--D--Y--S--Q--W--G--Q--W--S--Q--V--Y-
ACATGTGGTTAAATGCTATTGGGGTAAAGAATCTCCTGATATGACTAAAAACTTCCAACAGGTTGACTATAGTCAATGGGGCCAATGGAGCCAAGTGTAT
:::::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::.::::::::.::::::::::: :::
ACATGTTGTTAAATGCTATTGGGGTAAAGAATCTCCTGATATGACTAAAAACTTCCAACAGGTCGACTATAGTCAGTGGGGCCAGTGGAGCCAAGTTTAT
--H--V--V--K--C--Y--W--G--K--E--S--P--D--M--T--K--N--F--Q--Q--V--D--Y--S--Q--W--G--Q--W--S--Q--V--Y-

----------------------------------------------------------------------------------------------------
-G--N--P--Q--Q--Y--G--Q--Y--M--A--N--G--W--Q--V--P--P--Y--G--V--Y--G--Q--P--W--N--Q--Q--G--F--G--V--
GGAAACCCACAACAGTATGGACAGTATATGGCAAATGGGTGGCAAGTACCGCCTTATGGAGTATACGGGCAACCATGGAATCAACAAGGATTTGGAGTAG
:::::.::::::::::::::::::::::::::::::::::::::::::::.:::::.::::::::::::::.::::::::::::::::::::::::::: 
GGAAATCCACAACAGTATGGACAGTATATGGCAAATGGGTGGCAAGTACCACCTTACGGAGTATACGGGCAGCCATGGAATCAACAAGGATTTGGAGTA-
-G--N--P--Q--Q--Y--G--Q--Y--M--A--N--G--W--Q--V--P--P--Y--G--V--Y--G--Q--P--W--N--Q--Q--G--F--G--V--

><--------------------------------------------------------------------------------------------------
D--Q--S--P--S--A--A--W--M--G--G--F--G--A--Q--P--P--Q--G--Q--A--P--P--P--V--I--P--P--P--N--Q--A--G--Y
ATCAATCACCTTCTGCTGCTTGGATGGGTGGATTTGGTGCTCAGCCTCCCCAAGGACAAGCTCCTCCCCCTGTAATACCTCCTCCTAACCAAGCCGGATA
  ::::::::::: :::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::.:::::.::.:::::
--CAATCACCTTCAGCTGCTTGGATGGGTGGATTTGGTGCTCAGCCTCCCCAAGGACAAGCCCCTCCCCCTGTAATACCTCCTCCCAACCAGGCTGGATA
---Q--S--P--S--A--A--W--M--G--G--F--G--A--Q--P--P--Q--G--Q--A--P--P--P--V--I--P--P--P--N--Q--A--G--Y

--------------------------->
--G--M--A--S--Y--Q--T--Q--*-
TGGTATGGCAAGTTACCAAACACAGTGA
:::.::::: ::::::::::::::::::
TGGCATGGCCAGTTACCAAACACAGTGA
--G--M--A--S--Y--Q--T--Q--*-

Pig Consensus Sequence

>BGISUST0000884706
ATGATGGAAGACGACGGGCAGCCCCGGACT---TACGTAGGTAACCTCTCCAGAGATGTAACAGAAGTTCTTATTCTTCAGTTATTCAGTCAGATTGGAC
CCTGTAAAAGCTGTAAAATGATAACAGAGCATACAAGCAATGACCCATATTGCTTTGTGGAATTTTATGAACACAGAGATGCAGCTGCTGCATTAGCTGC
TATGAATGGGAGAAAAATTTTGGGAAAGGAGGTCAGAGTAAACTGGGCAACAACACCAAGTAGCCAGAAAAAAGATACTTCC---CATTTCCATGTGTTT
GTTGGGGATTTGAGTCCAGAAATTACAGCAGAAGATATCAAATCAGCATTCACCTCCTTTGGTAAAATA---GATGCCCGAGTAGTTAAAGATATGGCAA
CTGGAAAATCTAAAGGCTATGGCTTTGTATCTTTTTATAACAAACTGGATGCAGAAAATGCAATTGTGCATATGGGAGGTCAGTGGTTGGGTGGTCGTCA
AATCAGAACCAATTGGGCCACACGTAAACCACCTGCACCTAAAAGTACACAAGAA---AACACTAAGCAGTTGAGATTTGAAGATGTAGTAAACCAGTCA
AGTCCAAAAAATTGTACTGTGTACTGTGGAGGAATTGCTTCTGGGTTAACA---CAACTTATGAGACAAACATTTTCACCATTTGGACAAATTATGGAGA
TAAGAGTTTTTCCAGAGAAGGGGTATTCGTTTGTC---TTTTCCACCCACGAAAGTGCAGCCCATGCCATTGTCTCAGTGAATGGTACTACGATCGAAGG
ACATGTTGTTAAATGCTATTGGGGTAAAGAATCTCCTGATATGACTAAAAACTTCCAACAGGTCGACTATAGTCAGTGGGGCCAGTGGAGCCAAGTTTAT
GGAAATCCACAACAGTATGGACAGTATATGGCAAATGGGTGGCAAGTACCACCTTACGGAGTATACGGGCAGCCATGGAATCAACAAGGATTTGGAGTA-
--CAATCACCTTCAGCTGCTTGGATGGGTGGATTTGGTGCTCAGCCTCCCCAAGGACAAGCCCCTCCCCCTGTAATACCTCCTCCCAACCAGGCTGGATA
TGGCATGGCCAGTTACCAAACACAGTGA


>BGISUSP0000884706
MMEDDGQPRT-YVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVRVNWATTPSSQKKDTS-HFHVF
VGDLSPEITAEDIKSAFTSFGKI-DARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQE-NTKQLRFEDVVNQS
SPKNCTVYCGGIASGLT-QLMRQTFSPFGQIMEIRVFPEKGYSFV-FSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVY
GNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGV-QSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ*