Sequences
EST Library Info
ret3Retina
tes2Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000165807 (click for geneview)
Transcript ID ENST00000298705(link to ensembl)
Symbol NP_758953.1
Localtion Chromosome:14:64086373:64125849:1 band: 14q23.3
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------><------------------------------
-M--Y--R--V--P--E--F--Y--A--R--R--K--R--L--G--G--Q--T--P--Y--L--M--D--Q--L--G--L--R--L--G--M--W--Y--
ATGTACCGGGTGCCCGAGTTTTATGCGAGGAGGAAGCGGTTAGGTGGGCAGACCCCTTACTTGATGGATCAGTTGGGATTACGATTAGGGATGTGGTACT
                                                                     ::::::::::::::::: :::::::::::::
---------------------------------------------------------------------CAGTTGGGATTACGATTTGGGATGTGGTACT
----------------------------------------------------------------------Q--L--G--L--R--F--G--M--W--Y--

---------------------------------><----------------------------------------------><-----------------
W--K--D--E--T--R--T--L--E--F--R--R--F--A--A--E--D--S--V--Q--W--L--L--K--H--H--P--H--F--T--P--A--A--E
GGAAAGATGAAACCAGAACTCTTGAATTCAGAAGGTTTGCCGCAGAAGATTCTGTCCAGTGGCTCCTGAAACATCACCCTCATTTTACACCTGCAGCAGA
::::::::::::::::::::::::::::::::                                                                    
GGAAAGATGAAACCAGAACTCTTGAATTCAGA--------------------------------------------------------------------
W--K--D--E--T--R--T--L--E--F--R---------------------------------------------------------------------

--------------------------------------------------------------------><------------------------------
--V--K--E--K--G--K--K--G--K--A--V--H--F--A--E--T--D--G--P--A--S--D--R--L--T--D--K--R--L--A--A--K--D-
AGTCAAGGAAAAAGGAAAGAAAGGCAAAGCAGTTCACTTTGCAGAAACTGATGGTCCAGCTTCAGACAGGTTGACAGATAAAAGACTTGCTGCAAAAGAT
    :::::::.:::::.::.::::::::::::::::::::: ::::::::::::::::::::::::                                 
----AAGGAAAGAGGAAGGAGAGGCAAAGCAGTTCACTTTGCTGAAACTGATGGTCCAGCTTCAGAC---------------------------------
-----K--E--R--G--R--R--G--K--A--V--H--F--A--E--T--D--G--P--A--S--D----------------------------------

------------------------------------------------------------------><--------------------------------
-D--K--S--A--K--A--V--E--K--R--G--Q--Q--G--T--I--T--L--D--D--V--K--F--V--T--L--L--L--L--Q--D--T--E--
GATAAGTCAGCTAAAGCTGTAGAGAAACGAGGTCAACAGGGCACCATTACACTGGATGATGTTAAATTTGTTACTTTGCTTTTGCTACAAGATACTGAGA
                                                                     :::.:::::::::::::::::::::::::::
---------------------------------------------------------------------GTTGCTTTGCTTTTGCTACAAGATACTGAGA
----------------------------------------------------------------------V--A--L--L--L--L--Q--D--T--E--

---------------------------------><-----------------------------------------------------------------
M--Q--R--I--C--S--F--T--T--F--M--R--N--K--N--L--D--N--F--L--M--A--L--L--Y--Y--L--S--H--Y--L--E--K--N
TGCAGCGGATCTGTTCTTTTACAACATTTATGAGGAATAAGAATCTTGATAATTTCCTCATGGCATTATTGTACTACTTATCCCATTACTTGGAAAAAAA
::::::: ::::::::.:::::::::::::::   :::::: :::::::.::::::::.:::::.::.::::::::.:::: ..::: ::::::::::: 
TGCAGCGTATCTGTTCCTTTACAACATTTATG---AATAAGTATCTTGACAATTTCCTTATGGCGTTGTTGTACTATTTATATTATTTCTTGGAAAAAAT
M--Q--R--I--C--S--F--T--T--F--M-----N--K--Y--L--D--N--F--L--M--A--L--L--Y--Y--L--Y--Y--F--L--E--K--I

--------------------------------><------------------------------------------------------------------
--S--L--E--K--K--P--K--S--Y--M--V--G--L--V--E--K--K--E--M--E--L--V--L--S--E--L--E--A--A--Q--R--Y--L-
CTCACTGGAAAAGAAACCCAAAAGCTATATGGTAGGCCTTGTAGAGAAAAAAGAAATGGAATTGGTTTTAAGTGAATTAGAAGCAGCACAGAGGTACTTG
::::.: ::.:::.:::::::::::::::::   ::::::::::::::::::::.::::::.: ::: : :::.:.::::::: ::::::::..::::::
CTCATTTGAGAAGGAACCCAAAAGCTATATG---GGCCTTGTAGAGAAAAAAGAGATGGAACTTGTTATCAGTAAGTTAGAAGAAGCACAGAAATACTTG
--S--F--E--K--E--P--K--S--Y--M-----G--L--V--E--K--K--E--M--E--L--V--I--S--K--L--E--E--A--Q--K--Y--L-

-------------------------------------------------------------------><-------------------------------
-A--Q--K--Y--C--I--L--V--L--G--L--A--V--P--D--K--H--H--M--C--C--G--K--E--K--I--S--D--T--Q--K--D--W--
GCGCAGAAGTACTGTATCCTTGTGCTGGGCTTGGCCGTGCCGGATAAGCATCACATGTGCTGTGGAAAGGAGAAAATATCAGATACACAGAAAGACTGGA
:::::::::::::::.::::..: ::::::::::  .:::: ::::::::::::::::::::::::   :::::::::::::::::::::::::::::::
GCGCAGAAGTACTGTGTCCTCATCCTGGGCTTGGGAATGCCTGATAAGCATCACATGTGCTGTGGA---GAGAAAATATCAGATACACAGAAAGACTGGA
-A--Q--K--Y--C--V--L--I--L--G--L--G--M--P--D--K--H--H--M--C--C--G-----E--K--I--S--D--T--Q--K--D--W--

----------><----------------------------------------------------------------------------------------
K--F--F--E--S--F--Y--T--F--C--T--Y--V--A--W--I--V--F--R--R--Q--H--L--T--E--I--E--E--E--V--G--R--L--F
AGTTCTTTGAGTCCTTTTATACTTTCTGTACATATGTGGCTTGGATTGTCTTCCGACGTCAACACTTGACAGAGATTGAAGAAGAAGTAGGGAGACTCTT
:.::::::::::::::::::::.::::::::.::.::.::.::::::::::::::::::::.::::: ::::::::.::.::::::.:::::::.:::::
AATTCTTTGAGTCCTTTTATACCTTCTGTACGTACGTAGCCTGGATTGTCTTCCGACGTCAGCACTTCACAGAGATCGAGGAAGAAATAGGGAGGCTCTT
K--F--F--E--S--F--Y--T--F--C--T--Y--V--A--W--I--V--F--R--R--Q--H--F--T--E--I--E--E--E--I--G--R--L--F

-----------------------------------------------------------------------------------------><---------
--R--T--N--M--F--N--I--P--R--R--R--R--E--D--E--E--S--G--G--E--K--K--R--M--T--F--V--Q--F--R--R--M--M-
TCGTACCAATATGTTCAACATTCCTCGCAGGAGGCGTGAAGATGAGGAATCAGGAGGGGAAAAGAAACGCATGACTTTTGTTCAGTTCAGGAGAATGATG
:::: :::..::::::::::::::::: ::::..:::::.:::::.: ::: ::::::::.:::::::::::::::::::: ::::::   :::::::::
TCGTTCCAGCATGTTCAACATTCCTCGAAGGAAACGTGAGGATGAAGCATCCGGAGGGGAGAAGAAACGCATGACTTTTGTACAGTTC---AGAATGATG
--R--S--S--M--F--N--I--P--R--R--K--R--E--D--E--A--S--G--G--E--K--K--R--M--T--F--V--Q--F-----R--M--M-

----------------------------------------------------------------------------------------------------
-A--K--R--P--A--I--K--K--A--I--N--M--R--S--P--V--M--S--T--L--L--P--S--L--R--E--K--A--Q--N--V--F--E--
GCAAAACGCCCAGCAATTAAAAAAGCTATCAACATGCGTTCTCCAGTCATGTCTACTCTGCTGCCATCTCTCAGAGAAAAAGCTCAAAACGTCTTTGAGA
::::.:::::::::.:::::::::::.:::::::::::.::::::::..::::.::::::::::: :::::::::::.::::::::.::.::::.:::::
GCAAGACGCCCAGCGATTAAAAAAGCCATCAACATGCGCTCTCCAGTTGTGTCCACTCTGCTGCCCTCTCTCAGAGAGAAAGCTCAGAATGTCTCTGAGA
-A--R--R--P--A--I--K--K--A--I--N--M--R--S--P--V--V--S--T--L--L--P--S--L--R--E--K--A--Q--N--V--S--E--

---------------------------------------------------------------------------------><-----------------
K--K--Y--H--Q--V--D--V--R--F--P--A--E--M--Q--K--H--V--G--T--L--D--S--V--P--M--P--V--V--G--I--L--G--E
AAAAGTATCATCAAGTAGACGTCAGATTCCCAGCCGAGATGCAAAAGCATGTGGGAACTCTGGACTCTGTGCCCATGCCGGTAGTTGGCATCTTGGGGGA
:::::::.:.::: ::::::.:::.:::::::::..:::.::::.::::.. ::.:: .:::::::::.::. ::::                       
AAAAGTACCGTCACGTAGACATCAAATTCCCAGCTAAGACGCAAGAGCACAAGGAAAACCTGGACTCTATGTACATG-----------------------
K--K--Y--R--H--V--D--I--K--F--P--A--K--T--Q--E--H--K--E--N--L--D--S--M--Y--M------------------------

----------------------------------------------------------------------------------------------------
--P--R--C--L--F--N--P--H--T--L--H--P--L--D--P--E--E--N--T--K--S--F--G--R--Y--P--S--L--M--E--N--N--N-
GCCTCGATGTCTATTCAACCCACATACGCTTCACCCCCTTGATCCAGAAGAAAACACAAAATCATTTGGGAGATATCCTTCCTTGATGGAAAACAATAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------->
-M--R--I--Q--D--T--L--D--L--V--M--K--T--L--S--S--H--T--S--C--P--K--*-
ATGAGGATTCAGGATACACTGGACTTGGTCATGAAAACACTGTCCTCTCATACATCATGCCCTAAGTAA
                                                                     
---------------------------------------------------------------------
---------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000877727
---------------------------------------------------------------------CAGTTGGGATTACGATTTGGGATGTGGTACT
GGAAAGATGAAACCAGAACTCTTGAATTCAGA--------------------------------------------------------------------
----AAGGAAAGAGGAAGGAGAGGCAAAGCAGTTCACTTTGCTGAAACTGATGGTCCAGCTTCAGAC---------------------------------
---------------------------------------------------------------------GTTGCTTTGCTTTTGCTACAAGATACTGAGA
TGCAGCGTATCTGTTCCTTTACAACATTTATG---AATAAGTATCTTGACAATTTCCTTATGGCGTTGTTGTACTATTTATATTATTTCTTGGAAAAAAT
CTCATTTGAGAAGGAACCCAAAAGCTATATG---GGCCTTGTAGAGAAAAAAGAGATGGAACTTGTTATCAGTAAGTTAGAAGAAGCACAGAAATACTTG
GCGCAGAAGTACTGTGTCCTCATCCTGGGCTTGGGAATGCCTGATAAGCATCACATGTGCTGTGGA---GAGAAAATATCAGATACACAGAAAGACTGGA
AATTCTTTGAGTCCTTTTATACCTTCTGTACGTACGTAGCCTGGATTGTCTTCCGACGTCAGCACTTCACAGAGATCGAGGAAGAAATAGGGAGGCTCTT
TCGTTCCAGCATGTTCAACATTCCTCGAAGGAAACGTGAGGATGAAGCATCCGGAGGGGAGAAGAAACGCATGACTTTTGTACAGTTC---AGAATGATG
GCAAGACGCCCAGCGATTAAAAAAGCCATCAACATGCGCTCTCCAGTTGTGTCCACTCTGCTGCCCTCTCTCAGAGAGAAAGCTCAGAATGTCTCTGAGA
AAAAGTACCGTCACGTAGACATCAAATTCCCAGCTAAGACGCAAGAGCACAAGGAAAACCTGGACTCTATGTACATG-----------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------


>BGISUSP0000877727
-----------------------QLGLRFGMWYWKDETRTLEFR------------------------KERGRRGKAVHFAETDGPASD-----------
-----------------------VALLLLQDTEMQRICSFTTFM-NKYLDNFLMALLYYLYYFLEKISFEKEPKSYM-GLVEKKEMELVISKLEEAQKYL
AQKYCVLILGLGMPDKHHMCCG-EKISDTQKDWKFFESFYTFCTYVAWIVFRRQHFTEIEEEIGRLFRSSMFNIPRRKREDEASGGEKKRMTFVQF-RMM
ARRPAIKKAINMRSPVVSTLLPSLREKAQNVSEKKYRHVDIKFPAKTQEHKENLDSMYM-----------------------------------------
-----------------------