Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000166166 (click for geneview)
Transcript ID ENST00000299201(link to ensembl)
Symbol NP_689520.1
Localtion Chromosome:14:103065262:103072135:1 band: 14q32.32
Description  
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--S--F--V--A--Y--E--E--L--I--K--E--G--D--T--A--I--L--S--L--G--H--G--A--M--V--A--V--R--V--Q--R--G--
ATGAGCTTCGTGGCATACGAGGAGCTGATCAAGGAGGGTGACACGGCCATCCTGTCACTGGGCCATGGTGCAATGGTGGCGGTGCGTGTGCAGCGTGGGG
::::::::.:::::.:::::::::::::::::.:::::::::::.:::::::::::.::::::::::::::::::::::: ::.:::::.::::::::::
ATGAGCTTTGTGGCGTACGAGGAGCTGATCAAAGAGGGTGACACAGCCATCCTGTCGCTGGGCCATGGTGCAATGGTGGCCGTACGTGTACAGCGTGGGG
-M--S--F--V--A--Y--E--E--L--I--K--E--G--D--T--A--I--L--S--L--G--H--G--A--M--V--A--V--R--V--Q--R--G--

----------------------------------------------------------------------------------------------------
A--Q--T--Q--T--R--H--G--V--L--R--H--S--V--D--L--I--G--R--P--F--G--S--K--V--T--C--G--R--G--G--W--V--Y
CACAGACCCAGACCCGGCATGGTGTCCTGCGGCACTCAGTTGACCTTATCGGCCGCCCCTTCGGCTCCAAGGTGACGTGCGGCCGAGGTGGCTGGGTGTA
: :::::::::::::::::.::.::::::::.:::::.:: :::::.::.:::::::: ::.:::::::::::::: :::::::: ::::::::::::::
CCCAGACCCAGACCCGGCACGGCGTCCTGCGACACTCGGTAGACCTCATTGGCCGCCCGTTTGGCTCCAAGGTGACCTGCGGCCGTGGTGGCTGGGTGTA
A--Q--T--Q--T--R--H--G--V--L--R--H--S--V--D--L--I--G--R--P--F--G--S--K--V--T--C--G--R--G--G--W--V--Y

----------------------------------------------------------------------------------------------------
--V--L--H--P--T--P--E--L--W--T--L--N--L--P--H--R--T--Q--I--L--Y--S--T--D--I--A--L--I--T--M--M--L--E-
TGTGCTGCACCCCACGCCCGAGCTCTGGACGCTGAACCTGCCGCACCGCACGCAGATCCTCTACTCCACAGACATCGCCCTCATCACCATGATGTTGGAG
:::::::::::: ::::::::::::::::::::::::::::::::::: :::::::::::::::::::: :::::::::::  :::::::::::.:::::
TGTGCTGCACCCGACGCCCGAGCTCTGGACGCTGAACCTGCCGCACCGGACGCAGATCCTCTACTCCACTGACATCGCCCTGCTCACCATGATGCTGGAG
--V--L--H--P--T--P--E--L--W--T--L--N--L--P--H--R--T--Q--I--L--Y--S--T--D--I--A--L--L--T--M--M--L--E-

------------------------------><--------------------------------------------------------------------
-L--R--P--G--S--V--V--C--E--S--G--T--G--S--G--S--V--S--H--A--I--I--R--T--I--A--P--T--G--H--L--H--T--
CTTCGGCCCGGCTCTGTGGTCTGTGAGTCTGGCACCGGCAGTGGCTCTGTGTCCCACGCCATCATCCGCACCATTGCACCCACGGGTCACCTGCACACGG
::::::::.::::::::::::            ::::::::.::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::
CTTCGGCCTGGCTCTGTGGTC------------ACCGGCAGCGGCTCTGTGTCCCACGCCATCATCCGCACCATTGCACCCACGGGCCACCTGCACACGG
-L--R--P--G--S--V--V--------------T--G--S--G--S--V--S--H--A--I--I--R--T--I--A--P--T--G--H--L--H--T--

----------------------------------------------------------------------------------------------------
V--E--F--H--Q--Q--R--A--E--K--A--R--E--E--F--Q--E--H--R--V--G--R--W--V--T--V--R--T--Q--D--V--C--R--S
TGGAGTTCCACCAGCAGCGGGCAGAGAAGGCCCGGGAGGAGTTCCAGGAGCACCGTGTGGGCCGCTGGGTGACTGTGCGCACCCAGGACGTGTGCCGCAG
::::::::::::::::::::::.::::::::.:::::::::::::::::::::::.:::::::: ::::::::.::.:::: ::::::::::::.:::::
TGGAGTTCCACCAGCAGCGGGCGGAGAAGGCTCGGGAGGAGTTCCAGGAGCACCGCGTGGGCCGGTGGGTGACCGTACGCAACCAGGACGTGTGTCGCAG
V--E--F--H--Q--Q--R--A--E--K--A--R--E--E--F--Q--E--H--R--V--G--R--W--V--T--V--R--N--Q--D--V--C--R--S

-------------------------------------------------------------------------------------------------><-
--G--F--G--V--S--H--V--A--D--A--V--F--L--D--I--P--S--P--W--E--A--V--G--H--A--W--D--A--L--K--V--E--G-
TGGCTTTGGCGTGAGCCACGTGGCCGACGCCGTCTTCCTGGACATCCCATCACCCTGGGAGGCCGTGGGCCACGCCTGGGACGCCCTCAAGGTCGAAGGC
.::::::::::::::::::::::: :::::.::::::::::::::::: ::::: ::::::::::::::.:::::::::::.::.::::::::.:::   
CGGCTTTGGCGTGAGCCACGTGGCGGACGCTGTCTTCCTGGACATCCCCTCACCGTGGGAGGCCGTGGGTCACGCCTGGGATGCTCTCAAGGTTGAA---
--G--F--G--V--S--H--V--A--D--A--V--F--L--D--I--P--S--P--W--E--A--V--G--H--A--W--D--A--L--K--V--E----

----------------------------------------------------------------------------------------------------
-G--R--F--C--S--F--S--P--C--I--E--Q--V--Q--R--T--C--Q--A--L--A--A--R--G--F--S--E--L--S--T--L--E--V--
GGGCGCTTCTGCTCCTTCTCACCGTGCATCGAGCAGGTGCAACGCACATGCCAGGCGCTGGCAGCGCGCGGCTTCTCAGAGCTGAGCACCCTGGAGGTGC
::::::::::::::::::::.::::::::.:::::::::::.:::::.:::::::::::::..:: :::::::::::.::::::::::::::::::::::
GGGCGCTTCTGCTCCTTCTCGCCGTGCATTGAGCAGGTGCAGCGCACGTGCCAGGCGCTGGTGGCCCGCGGCTTCTCGGAGCTGAGCACCCTGGAGGTGC
-G--R--F--C--S--F--S--P--C--I--E--Q--V--Q--R--T--C--Q--A--L--V--A--R--G--F--S--E--L--S--T--L--E--V--

----------------------------------------------------------------------------------------------------
L--P--Q--V--Y--N--V--R--T--V--S--L--P--P--P--D--L--G--T--G--T--D--G--P--A--G--S--D--T--S--P--F--R--S
TGCCACAGGTCTACAACGTGCGCACTGTCAGCCTGCCACCGCCCGACCTGGGCACAGGCACAGATGGCCCTGCCGGCTCCGACACCAGCCCCTTCCGCAG
:::: ::::::::. :.::::::::.:::::::::::  ::::::::::::::.: .::             : :::.:::::.:: :::::::::::::
TGCCCCAGGTCTATCATGTGCGCACCGTCAGCCTGCCCGCGCCCGACCTGGGCGCCAGC------------CCGGGCCCCGACGCCCGCCCCTTCCGCAG
L--P--Q--V--Y--H--V--R--T--V--S--L--P--A--P--D--L--G--A--S--------------P--G--P--D--A--R--P--F--R--S

---------------------><-----------------------><----------------------------------------------------
--G--T--P--M--K--E--A--V--G--E--S--D--P--L--P--A--L--A--R--S--W--G--E--L--T--Q--N--P--C--P--A--L--P-
CGGCACGCCCATGAAGGAGGCCGTGGGGGAGTCTGACCCCCTCCCAGCCTTGGCCAGAAGCTGGGGTGAGCTGACCCAGAATCCCTGCCCTGCTCTCCCC
::::::::::::::::::::::                                                                              
CGGCACGCCCATGAAGGAGGCC------------------------------------------------------------------------------
--G--T--P--M--K--E--A-------------------------------------------------------------------------------

----------------------------------------------------------------->
-S--A--R--R--P--G--Q--P--R--N--Q--G--G--D--P--A--L--W--P--P--G--*-
AGCGCTAGGAGACCAGGCCAGCCCAGGAACCAGGGAGGTGACCCTGCTCTCTGGCCTCCTGGCTGA
                                                                  
------------------------------------------------------------------
------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000880501
ATGAGCTTTGTGGCGTACGAGGAGCTGATCAAAGAGGGTGACACAGCCATCCTGTCGCTGGGCCATGGTGCAATGGTGGCCGTACGTGTACAGCGTGGGG
CCCAGACCCAGACCCGGCACGGCGTCCTGCGACACTCGGTAGACCTCATTGGCCGCCCGTTTGGCTCCAAGGTGACCTGCGGCCGTGGTGGCTGGGTGTA
TGTGCTGCACCCGACGCCCGAGCTCTGGACGCTGAACCTGCCGCACCGGACGCAGATCCTCTACTCCACTGACATCGCCCTGCTCACCATGATGCTGGAG
CTTCGGCCTGGCTCTGTGGTC------------ACCGGCAGCGGCTCTGTGTCCCACGCCATCATCCGCACCATTGCACCCACGGGCCACCTGCACACGG
TGGAGTTCCACCAGCAGCGGGCGGAGAAGGCTCGGGAGGAGTTCCAGGAGCACCGCGTGGGCCGGTGGGTGACCGTACGCAACCAGGACGTGTGTCGCAG
CGGCTTTGGCGTGAGCCACGTGGCGGACGCTGTCTTCCTGGACATCCCCTCACCGTGGGAGGCCGTGGGTCACGCCTGGGATGCTCTCAAGGTTGAA---
GGGCGCTTCTGCTCCTTCTCGCCGTGCATTGAGCAGGTGCAGCGCACGTGCCAGGCGCTGGTGGCCCGCGGCTTCTCGGAGCTGAGCACCCTGGAGGTGC
TGCCCCAGGTCTATCATGTGCGCACCGTCAGCCTGCCCGCGCCCGACCTGGGCGCCAGCCCGGGCCCCGACGCCCGCCCCTTCCGCAGCGGCACGCCCAT
GAAGGAGGCC------------------------------------------------------------------------------------------
------------------------------------------------------


>BGISUSP0000880501
MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCGRGGWVYVLHPTPELWTLNLPHRTQILYSTDIALLTMMLE
LRPGSVV----TGSGSVSHAIIRTIAPTGHLHTVEFHQQRAEKAREEFQEHRVGRWVTVRNQDVCRSGFGVSHVADAVFLDIPSPWEAVGHAWDALKVE-
GRFCSFSPCIEQVQRTCQALVARGFSELSTLEVLPQVYHVRTVSLPAPDLGASPGPDARPFRSGTPMKEA------------------------------
------------------