Sequences
EST Library Info
pldo1Unavailable
sme2M. Semimembranosus
spl4Spleen
tes1Testes
Clusters
Oligos
SNPs

Gene ID ENSG00000166734 (click for geneview)
Transcript ID ENST00000299957(link to ensembl)
Symbol NP_612432.2
Localtion Chromosome:15:42368221:42495247:1 band: 15q15.3
Description H63 breast cancer expressed gene isoform a
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--V--G--F--G--A--N--R--R--A--G--R--L--P--S--L--V--L--V--V--L--L--V--V--I--V--V--L--A--F--N--Y--W--
ATGGTGGGTTTCGGGGCCAACCGGCGGGCTGGCCGCCTGCCCTCTCTCGTGCTGGTGGTGCTGCTGGTGGTGATCGTCGTCCTCGCCTTCAACTACTGGA
::::: ::::::::::::::::::::::: ::::::::::::::..:::::.::::::: :::::::: :::::::..::::::::::::::::::::::
ATGGTCGGTTTCGGGGCCAACCGGCGGGCGGGCCGCCTGCCCTCCTTCGTGTTGGTGGTCCTGCTGGTCGTGATCGCTGTCCTCGCCTTCAACTACTGGA
-M--V--G--F--G--A--N--R--R--A--G--R--L--P--S--F--V--L--V--V--L--L--V--V--I--A--V--L--A--F--N--Y--W--

----------------------------------------------------------------------------------------------------
S--I--S--S--R--H--V--L--L--Q--E--E--V--A--E--L--Q--G--Q--V--Q--R--T--E--V--A--R--G--R--L--E--K--R--N
GCATCTCCTCCCGCCACGTCCTGCTTCAGGAGGAGGTGGCCGAGCTGCAGGGCCAGGTCCAGCGCACCGAAGTGGCCCGCGGGCGGCTGGAAAAGCGCAA
::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::: ::.::.::::::::::: :::::.::::::::
GCATCTCCTCCCGCCACGTCCTGCTTCAGGAGGAAGTGGCCGAGCTGCAGGGCCAGGTCCAGCGCACAGAGGTAGCCCGCGGGCGCCTGGAGAAGCGCAA
S--I--S--S--R--H--V--L--L--Q--E--E--V--A--E--L--Q--G--Q--V--Q--R--T--E--V--A--R--G--R--L--E--K--R--N

----------------------------------------------------------------------------------------------------
--S--D--L--L--L--L--V--D--T--H--K--K--Q--I--D--Q--K--E--A--D--Y--G--R--L--S--S--R--L--Q--A--R--E--G-
TTCGGACCTCTTGCTGTTGGTGGACACGCACAAGAAACAGATCGACCAGAAGGAGGCCGACTACGGCCGCCTCAGCAGCCGGCTGCAGGCCAGAGAGGGC
::::::::::.:::: ::::::::: :::::::::::::::: ::::::::.:::::::::::::::::::::::::::::::::::::::::.::::::
TTCGGACCTCCTGCTCTTGGTGGACTCGCACAAGAAACAGAT-GACCAGAAAGAGGCCGACTACGGCCGCCTCAGCAGCCGGCTGCAGGCCAGGGAGGGC
--S--D--L--L--L--L--V--D--S--H--K--K--Q--I--D--Q--K--E--A--D--Y--G--R--L--S--S--R--L--Q--A--R--E--G-

-----------------------------><-----------------------------------------------------><--------------
-L--G--K--R--C--E--D--D--K--V--K--L--Q--N--N--I--S--Y--Q--M--A--D--I--H--H--L--K--E--Q--L--A--E--L--
CTCGGGAAGAGATGCGAGGATGACAAGGTTAAACTACAGAACAACATATCGTATCAGATGGCAGACATACATCATTTAAAGGAGCAACTTGCTGAGCTTC
::::::::.:::::::::::::::::::::::::::::::::::::::::.::::::::::: :::::::.:::::::      ::::::::::::::::
CTCGGGAAAAGATGCGAGGATGACAAGGTTAAACTACAGAACAACATATCATATCAGATGGCTGACATACGTCATTTA------CAACTTGCTGAGCTTC
-L--G--K--R--C--E--D--D--K--V--K--L--Q--N--N--I--S--Y--Q--M--A--D--I--R--H--L--------Q--L--A--E--L--

---------------------------------------------------------------------------------------><-----------
R--Q--E--F--L--R--Q--E--D--Q--L--Q--D--Y--R--K--N--N--T--Y--L--V--K--R--L--E--Y--E--S--F--Q--C--G--Q
GTCAGGAATTTCTTCGACAAGAAGACCAGCTTCAGGACTATAGGAAGAACAATACTTACCTTGTGAAGAGGTTAGAATATGAAAGTTTTCAGTGTGGACA
:.:::::.:::::::::::.::::::::::::::::::::::::::.:::::::::::::::::::::::.:::::::::      ::::::::::::::
GCCAGGAGTTTCTTCGACAGGAAGACCAGCTTCAGGACTATAGGAAAAACAATACTTACCTTGTGAAGAGATTAGAATAT------TTTCAGTGTGGACA
R--Q--E--F--L--R--Q--E--D--Q--L--Q--D--Y--R--K--N--N--T--Y--L--V--K--R--L--E--Y--------F--Q--C--G--Q

------------------------------------------------------------------------------><--------------------
--Q--M--K--E--L--R--A--Q--H--E--E--N--I--K--K--L--A--D--Q--F--L--E--E--Q--K--Q--E--T--Q--K--I--Q--S-
GCAGATGAAGGAATTGAGAGCACAGCATGAAGAAAATATTAAAAAGTTAGCAGACCAGTTTTTAGAGGAACAAAAGCAAGAGACCCAAAAGATTCAATCA
.::::: ::::::::.::::: :::::::::::::::::::::::.:::::::::::::::::. :::::::::::::::::::::: ::: :: :::::
ACAGATCAAGGAATTAAGAGCTCAGCATGAAGAAAATATTAAAAAATTAGCAGACCAGTTTTTGCAGGAACAAAAGCAAGAGACCCACAAGTTTGAATCA
--Q--I--K--E--L--R--A--Q--H--E--E--N--I--K--K--L--A--D--Q--F--L--Q--E--Q--K--Q--E--T--H--K--F--E--S-

----------------------------------------------------------------------------------------------------
-N--D--G--K--E--L--D--I--N--N--Q--V--V--P--K--N--I--P--K--V--A--E--N--V--A--D--K--N--E--E--P--S--S--
AATGATGGAAAGGAATTGGATATAAACAATCAAGTAGTACCTAAAAATATTCCAAAAGTAGCTGAGAATGTTGCAGATAAGAATGAAGAACCCTCAAGCA
:: .::.:::: :::::::::::::::::::: :.:::.::::.:::.::.::::::::::  :::::::.::::::.::::::.:::::::::::::::
AAAAATAGAAATGAATTGGATATAAACAATCATGCAGTGCCTAGAAACATCCCAAAAGTAGAGGAGAATGCTGCAGACAAGAATAAAGAACCCTCAAGCA
-K--N--R--N--E--L--D--I--N--N--H--A--V--P--R--N--I--P--K--V--E--E--N--A--A--D--K--N--K--E--P--S--S--

-----------------------><---------------------------------------------------------------------------
N--H--I--P--H--G--K--E--Q--I--K--R--G--G--D--A--G--M--P--G--I--E--E--N--D--L--A--K--V--D--D--L--P--P
ATCATATTCCACATGGGAAAGAACAAATCAAAAGAGGTGGTGATGCAGGGATGCCTGGAATAGAAGAGAATGACCTAGCAAAAGTTGATGATCTTCCCCC
::::.: :::::::::::::                                                                                
ATCACAATCCACATGGGAAA--------------------------------------------------------------------------------
N--H--N--P--H--G--K---------------------------------------------------------------------------------

----><----------------------------------------------------------------------------------------------
--A--L--R--K--P--P--I--S--V--S--Q--H--E--S--H--Q--A--I--S--H--L--P--T--G--Q--P--L--S--P--N--M--P--P-
TGCTTTAAGGAAGCCTCCTATTTCAGTTTCTCAACATGAAAGTCATCAAGCAATCTCCCATCTTCCAACTGGACAACCTCTCTCCCCAAATATGCCTCCA
          :.:::.::: ::::  ::::::::.::::::::::::::.:::: ::::::::::::::::::::.::::: :::::::::         
----------AGGCCCCCTCTTTCCTTTTCTCAATATGAAAGTCATCAAACAATATCCCATCTTCCAACTGGACAGCCTCTGTCCCCAAAT---------
-----------R--P--P--L--S--F--S--Q--Y--E--S--H--Q--T--I--S--H--L--P--T--G--Q--P--L--S--P--N----------

---><-----------------------------------------------------------------------------------------------
-D--S--H--I--N--H--N--G--N--P--G--T--S--K--Q--N--P--S--S--P--L--Q--R--L--I--P--G--S--N--L--D--S--E--
GATTCACACATAAACCACAATGGAAACCCCGGTACTTCAAAACAGAATCCTTCCAGTCCTCTTCAGCGTTTAATTCCAGGCTCAAACTTGGACAGTGAAC
   :: ::..: ::::::::::::::::::.: ::::::::::::::.:::::::.::::::::::::: :::::::::::.: :::::::: :.:::::
---TCTCATGTCAACCACAATGGAAACCCCAGAACTTCAAAACAGAACCCTTCCAATCCTCTTCAGCGTATAATTCCAGGCCCTAACTTGGAGAATGAAC
----S--H--V--N--H--N--G--N--P--R--T--S--K--Q--N--P--S--N--P--L--Q--R--I--I--P--G--P--N--L--E--N--E--

--------------------------------------------------------------------------><------------------------
P--R--I--Q--T--D--I--L--K--Q--A--T--K--D--R--V--S--D--F--H--K--L--K--Q--S--R--F--F--D--E--N--E--S--P
CCAGAATTCAAACAGATATACTAAAGCAGGCTACCAAGGACAGAGTCAGTGATTTCCATAAATTGAAGCAAAGCCGATTCTTTGATGAAAATGAATCCCC
:::::::::::.::::::: :::::.:::::::::::::::::::.:.:::::::::::::::::::::::   ::::::::::::::.:::::::::::
CCAGAATTCAAGCAGATATTCTAAAACAGGCTACCAAGGACAGAGCCGGTGATTTCCATAAATTGAAGCAA---CGATTCTTTGATGAGAATGAATCCCC
P--R--I--Q--A--D--I--L--K--Q--A--T--K--D--R--A--G--D--F--H--K--L--K--Q-----R--F--F--D--E--N--E--S--P

----------------------------------------------------------------------------------------------------
--V--D--P--Q--H--G--S--K--L--A--D--Y--N--G--D--D--G--N--V--G--E--Y--E--A--D--K--Q--A--E--L--A--Y--N-
TGTTGATCCGCAGCATGGCTCTAAACTGGCGGATTATAATGGGGATGATGGTAACGTAGGTGAGTATGAGGCAGACAAGCAGGCTGAGCTGGCTTACAAT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::
TGTTGATCCGCAGCATGGCTCTAAACTGGCGGATTATAATGGGGATGATGGTAACGTAGGTGAGTATGAGGCAGACAAGCAGGCTGAGCTGGCTTACAAT
--V--D--P--Q--H--G--S--K--L--A--D--Y--N--G--D--D--G--N--V--G--E--Y--E--A--D--K--Q--A--E--L--A--Y--N-

------------------------------------------><--------------------------------------------------------
-E--E--E--D--G--D--G--G--E--E--D--V--Q--D--D--E--E--R--E--L--Q--M--D--P--A--D--Y--G--K--Q--H--F--N--
GAGGAAGAAGATGGTGATGGTGGAGAGGAAGACGTCCAAGATGATGAAGAACGAGAGCTTCAAATGGATCCTGCAGACTATGGAAAGCAACATTTCAATG
:::::::::::::::::::::::::::::::::::::::   ::::::::::: ::.::::::::::::::::::::::::::::::::::.::::::::
GAGGAAGAAGATGGTGATGGTGGAGAGGAAGACGTCCAA---GATGAAGAACGTGAACTTCAAATGGATCCTGCAGACTATGGAAAGCAACGTTTCAATG
-E--E--E--D--G--D--G--G--E--E--D--V--Q-----D--E--E--R--E--L--Q--M--D--P--A--D--Y--G--K--Q--R--F--N--

-----------
D--V--L--*-
ATGTCCTTTAA
:::::::::::
ATGTCCTTTAA
D--V--L--*-

Pig Consensus Sequence

>BGISUST0000877776
ATGGTCGGTTTCGGGGCCAACCGGCGGGCGGGCCGCCTGCCCTCCTTCGTGTTGGTGGTCCTGCTGGTCGTGATCGCTGTCCTCGCCTTCAACTACTGGA
GCATCTCCTCCCGCCACGTCCTGCTTCAGGAGGAAGTGGCCGAGCTGCAGGGCCAGGTCCAGCGCACAGAGGTAGCCCGCGGGCGCCTGGAGAAGCGCAA
TTCGGACCTCCTGCTCTTGGTGGACTCGCACAAGAAACAggACCAGAAAGAGGCCGACTACGGCCGCCTCAGCAGCCGGCTGCAGGCCAGGGAGGGCCTC
GGGAAAAGATGCGAGGATGACAAGGTTAAACTACAGAACAACATATCATATCAGATGGCTGACATACGTCATTTA------CAACTTGCTGAGCTTCGCC
AGGAGTTTCTTCGACAGGAAGACCAGCTTCAGGACTATAGGAAAAACAATACTTACCTTGTGAAGAGATTAGAATAT------TTTCAGTGTGGACAACA
GATCAAGGAATTAAGAGCTCAGCATGAAGAAAATATTAAAAAATTAGCAGACCAGTTTTTGCAGGAACAAAAGCAAGAGACCCACAAGTTTGAATCAAAA
AATAGAAATGAATTGGATATAAACAATCATGCAGTGCCTAGAAACATCCCAAAAGTAGAGGAGAATGCTGCAGACAAGAATAAAGAACCCTCAAGCAATC
ACAATCCACATGGGAAA-----------------------------------------------------------------------------------
-------AGGCCCCCTCTTTCCTTTTCTCAATATGAAAGTCATCAAACAATATCCCATCTTCCAACTGGACAGCCTCTGTCCCCAAAT------------
TCTCATGTCAACCACAATGGAAACCCCAGAACTTCAAAACAGAACCCTTCCAATCCTCTTCAGCGTATAATTCCAGGCCCTAACTTGGAGAATGAACCCA
GAATTCAAGCAGATATTCTAAAACAGGCTACCAAGGACAGAGCCGGTGATTTCCATAAATTGAAGCAA---CGATTCTTTGATGAGAATGAATCCCCTGT
TGATCCGCAGCATGGCTCTAAACTGGCGGATTATAATGGGGATGATGGTAACGTAGGTGAGTATGAGGCAGACAAGCAGGCTGAGCTGGCTTACAATGAG
GAAGAAGATGGTGATGGTGGAGAGGAAGACGTCCAA---GATGAAGAACGTGAACTTCAAATGGATCCTGCAGACTATGGAAAGCAACGTTTCAATGATG
TCCTTTAA


>BGISUSP0000877776
MVGFGANRRAGRLPSFVLVVLLVVIAVLAFNYWSISSRHVLLQEEVAELQGQVQRTEVARGRLEKRNSDLLLLVDSHKKQDQKEADYGRLSSRLQAREGL
GKRCEDDKVKLQNNISYQMADIRHL--QLAELRQEFLRQEDQLQDYRKNNTYLVKRLEY--FQCGQQIKELRAQHEENIKKLADQFLQEQKQETHKFESK
NRNELDINNHAVPRNIPKVEENAADKNKEPSSNHNPHGK------------------------------RPPLSFSQYESHQTISHLPTGQPLSPN----
SHVNHNGNPRTSKQNPSNPLQRIIPGPNLENEPRIQADILKQATKDRAGDFHKLKQ-RFFDENESPVDPQHGSKLADYNGDDGNVGEYEADKQAELAYNE
EEDGDGGEEDVQ-DEERELQMDPADYGKQRFNDVL*