Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000166963 (click for geneview)
Transcript ID ENST00000300231(link to ensembl)
Symbol MAP1A
Localtion Chromosome:15:41597133:41611109:1 band: 15q15.3
Description Microtubule-associated protein 1A (MAP 1A) (Proliferation-related protein p80) [Contains: MAP1 light chain LC2]. [Source:Uniprot/SWISSPROT;Acc:P78559]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--D--G--V--A--E--F--S--E--Y--V--S--E--T--V--D--V--P--S--P--F--D--L--L--E--P--P--T--S--G--G--F--L--
ATGGACGGCGTGGCTGAGTTCTCCGAGTATGTCTCTGAGACTGTGGACGTGCCATCCCCATTTGACCTACTAGAGCCCCCCACCTCAGGGGGCTTCCTCA
:::::.::::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::.:: ::::::::::::::::::::::::::::
ATGGATGGCGTGGCTGAGTTCTCCGAGTATGTCTCTGAGACTGTGGACGTGCCATCCCCCTTTGACCTGCTTGAGCCCCCCACCTCAGGGGGCTTCCTCA
-M--D--G--V--A--E--F--S--E--Y--V--S--E--T--V--D--V--P--S--P--F--D--L--L--E--P--P--T--S--G--G--F--L--

----------------------------------------------------------------------------------------------------
K--L--S--K--P--C--C--Y--I--F--P--G--G--R--G--D--S--A--L--F--A--V--N--G--F--N--I--L--V--D--G--G--S--D
AGCTCTCCAAGCCTTGTTGCTACATCTTCCCAGGTGGTCGTGGGGACTCTGCCCTCTTTGCTGTCAATGGTTTCAACATCCTGGTGGATGGTGGCTCTGA
::::::::::::::::.:::::::::::::: ::.::.:: :::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::
AGCTCTCCAAGCCTTGCTGCTACATCTTCCCCGGCGGCCGAGGGGACTCTGCCCTCTTTGCTGTTAATGGTTTCAACATCCTGGTGGATGGTGGCTCTGA
K--L--S--K--P--C--C--Y--I--F--P--G--G--R--G--D--S--A--L--F--A--V--N--G--F--N--I--L--V--D--G--G--S--D

----------------------------------------------------------------------------------------------------
--R--K--S--C--F--W--K--L--V--R--H--L--D--R--I--D--S--V--L--L--T--H--I--G--A--D--N--L--P--G--I--N--G-
TCGCAAGTCCTGTTTTTGGAAGCTGGTACGGCACTTGGACCGCATTGACTCGGTGCTACTCACACACATTGGGGCAGACAACCTGCCAGGCATCAATGGA
::::::::::::.::.:::::::::::.::::::.:.::.:::::::::::::: .::::::: :::::.::::::::::::::::::::::::::.:::
TCGCAAGTCCTGCTTCTGGAAGCTGGTGCGGCACCTAGATCGCATTGACTCGGTTTTACTCACCCACATCGGGGCAGACAACCTGCCAGGCATCAACGGA
--R--K--S--C--F--W--K--L--V--R--H--L--D--R--I--D--S--V--L--L--T--H--I--G--A--D--N--L--P--G--I--N--G-

----------------------------------------------------------------------------------------------------
-L--L--Q--R--K--V--A--E--L--E--E--E--Q--S--Q--G--S--S--S--Y--S--D--W--V--K--N--L--I--S--P--E--L--G--
CTACTGCAGCGCAAAGTGGCAGAGCTAGAGGAGGAGCAGTCCCAGGGCTCTAGCAGTTACAGCGACTGGGTGAAGAACCTTATCTCTCCTGAGCTTGGAG
:: ::.:::::::::::::::::.::.:::::::::::::::::::::::.:::::.:::::::::::::::::::::::.:::::.:::::::::::::
CTCCTACAGCGCAAAGTGGCAGAACTGGAGGAGGAGCAGTCCCAGGGCTCCAGCAGCTACAGCGACTGGGTGAAGAACCTCATCTCCCCTGAGCTTGGAG
-L--L--Q--R--K--V--A--E--L--E--E--E--Q--S--Q--G--S--S--S--Y--S--D--W--V--K--N--L--I--S--P--E--L--G--

----------------------------------------------------------------------------------------------------
V--V--F--F--N--V--P--E--K--L--R--L--P--D--A--S--R--K--A--K--R--S--I--E--E--A--C--L--T--L--Q--H--L--N
TTGTCTTTTTCAACGTGCCTGAGAAGCTGCGGCTTCCTGATGCCTCCCGGAAAGCCAAGCGTAGCATTGAGGAGGCCTGCCTCACTCTGCAGCACTTAAA
:::::::.::.::::::::.:: ::::::::::: :::::::::::::::::.::::::::.:::::::::::::::::::::::::::::::::.:.::
TTGTCTTCTTTAACGTGCCCGATAAGCTGCGGCTGCCTGATGCCTCCCGGAAGGCCAAGCGCAGCATTGAGGAGGCCTGCCTCACTCTGCAGCACCTGAA
V--V--F--F--N--V--P--D--K--L--R--L--P--D--A--S--R--K--A--K--R--S--I--E--E--A--C--L--T--L--Q--H--L--N

----------------------------------------------------------------------------------------------------
--R--L--G--I--Q--A--E--P--L--Y--R--V--V--S--N--T--I--E--P--L--T--L--F--H--K--M--G--V--G--R--L--D--M-
CCGCCTGGGCATCCAGGCTGAGCCTCTATATCGTGTGGTCAGCAATACCATTGAGCCACTGACCCTCTTCCACAAAATGGGTGTGGGCCGGCTGGACATG
:::.::::::::::::::.::::: ::.::.::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::::::::::::
CCGTCTGGGCATCCAGGCCGAGCCACTGTACCGTGTGGTCAGCAACACCATTGAGCCACTGACCCTCTTCCACAAAATGGGTGTGGGCCGGCTGGACATG
--R--L--G--I--Q--A--E--P--L--Y--R--V--V--S--N--T--I--E--P--L--T--L--F--H--K--M--G--V--G--R--L--D--M-

----------------------------------------------------------------------------------------------------
-Y--V--L--N--P--V--K--D--S--K--E--M--Q--F--L--M--Q--K--W--A--G--N--S--K--A--K--T--G--I--V--L--P--N--
TATGTCCTCAACCCTGTCAAGGACAGCAAGGAGATGCAGTTCCTCATGCAAAAGTGGGCAGGCAATAGTAAAGCCAAGACAGGCATCGTGCTGCCCAATG
:::::::::::::: :::::.::::::::::::::::::::::::::::::::::::::::::::.::::::::.:::::::::::::::::: :.::::
TATGTCCTCAACCCGGTCAAAGACAGCAAGGAGATGCAGTTCCTCATGCAAAAGTGGGCAGGCAACAGTAAAGCTAAGACAGGCATCGTGCTGGCTAATG
-Y--V--L--N--P--V--K--D--S--K--E--M--Q--F--L--M--Q--K--W--A--G--N--S--K--A--K--T--G--I--V--L--A--N--

----------------------------------------------------------------------------------------------------
G--K--E--A--E--I--S--V--P--Y--L--T--S--I--T--A--L--V--V--W--L--P--A--N--P--T--E--K--I--V--R--V--L--F
GGAAGGAGGCTGAGATCTCCGTGCCCTACCTTACCTCTATCACTGCTCTGGTGGTCTGGCTACCAGCCAATCCCACTGAGAAGATTGTGCGTGTGCTTTT
:::::::::::::::::::::::::.::::: ::::: ::::::::::::::::::::::::::::::::.:::::.:::::::::::::::::::::::
GGAAGGAGGCTGAGATCTCCGTGCCTTACCTGACCTCAATCACTGCTCTGGTGGTCTGGCTACCAGCCAACCCCACCGAGAAGATTGTGCGTGTGCTTTT
G--K--E--A--E--I--S--V--P--Y--L--T--S--I--T--A--L--V--V--W--L--P--A--N--P--T--E--K--I--V--R--V--L--F

----------------------------------------------------------------------------------------------------
--P--G--N--A--P--Q--N--K--I--L--E--G--L--E--K--L--R--H--L--D--F--L--R--Y--P--V--A--T--Q--K--D--L--A-
TCCAGGAAATGCTCCCCAAAACAAGATCTTGGAGGGCCTAGAAAAGCTTCGGCATCTGGACTTCCTGCGTTACCCTGTGGCCACGCAGAAGGACCTGGCT
::::::.:::::::::::.::::::::::::::::::::.:::::::::::::::::::::::::::::.:::::.:::::::::::::::::::::::.
TCCAGGGAATGCTCCCCAGAACAAGATCTTGGAGGGCCTGGAAAAGCTTCGGCATCTGGACTTCCTGCGCTACCCCGTGGCCACGCAGAAGGACCTGGCC
--P--G--N--A--P--Q--N--K--I--L--E--G--L--E--K--L--R--H--L--D--F--L--R--Y--P--V--A--T--Q--K--D--L--A-

----------------------------------------------------------------------------------------------------
-S--G--A--V--P--T--N--L--K--P--S--K--I--K--Q--R--A--D--S--K--E--S--L--K--A--T--T--K--T--A--V--S--K--
TCTGGGGCTGTGCCTACCAACCTCAAGCCCAGCAAAATCAAACAGCGGGCTGATAGCAAGGAGAGCCTCAAAGCCACTACCAAGACGGCCGTGAGCAAGT
 ::::::::::::::.::::::::::.:::::::::::::::::::::::::::::::::::.::::::::.::::: ::::::::.::.:::::::::.
ACTGGGGCTGTGCCTGCCAACCTCAAACCCAGCAAAATCAAACAGCGGGCTGATAGCAAGGAAAGCCTCAAGGCCACAACCAAGACAGCTGTGAGCAAGC
-T--G--A--V--P--A--N--L--K--P--S--K--I--K--Q--R--A--D--S--K--E--S--L--K--A--T--T--K--T--A--V--S--K--

----------------------------------------------------------------------------------------------------
L--A--K--R--E--E--V--V--E--E--G--A--K--E--A--R--S--E--L--A--K--E--L--A--K--T--E--K--K--A--K--E--S--S
TGGCCAAACGGGAGGAGGTGGTAGAAGAGGGAGCCAAGGAGGCACGTTCAGAGCTGGCCAAGGAGTTAGCCAAGACAGAGAAGAAGGCAAAAGAGTCATC
:::::::::::::::::::::. :::::::::::::::::::: ::.:::::.::.::::::::.:::::::::::::::::::::::::::::::::::
TGGCCAAACGGGAGGAGGTGGCCGAAGAGGGAGCCAAGGAGGCCCGCTCAGAACTAGCCAAGGAATTAGCCAAGACAGAGAAGAAGGCAAAAGAGTCATC
L--A--K--R--E--E--V--A--E--E--G--A--K--E--A--R--S--E--L--A--K--E--L--A--K--T--E--K--K--A--K--E--S--S

----------------------------------------------------------------------------------------------------
--E--K--P--P--E--K--P--A--K--P--E--R--V--K--T--E--S--S--E--A--L--K--A--E--K--R--K--L--I--K--D--K--V-
TGAGAAGCCCCCAGAGAAGCCTGCCAAGCCTGAGAGGGTGAAGACAGAGTCAAGTGAGGCACTGAAGGCAGAGAAGCGAAAGCTGATCAAAGACAAGGTA
:::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.
TGAGAAGCCCCCAGAGAAGCCTGCCAAGCCTGAGAGGGTGAAGACAGAGTCGAGTGAGGCACTGAAGGCAGAGAAGCGAAAGCTGATCAAAGACAAGGTG
--E--K--P--P--E--K--P--A--K--P--E--R--V--K--T--E--S--S--E--A--L--K--A--E--K--R--K--L--I--K--D--K--V-

----------------------------------------------------------------------------------------------------
-G--K--K--H--L--K--E--K--I--S--K--L--E--E--K--K--D--K--E--K--K--E--I--K--K--E--R--K--E--L--K--K--D--
GGGAAAAAGCACCTTAAAGAAAAGATATCAAAGCTGGAAGAAAAAAAAGACAAGGAGAAAAAAGAGATCAAAAAGGAGAGGAAAGAGCTCAAGAAGGATG
:::::.:::::::: ::::::::::: ::::::::::::::::::::::::::.:::::::::::.:::::.:::::::::::.::::::::::::::::
GGGAAGAAGCACCTGAAAGAAAAGATTTCAAAGCTGGAAGAAAAAAAAGACAAAGAGAAAAAAGAAATCAAGAAGGAGAGGAAGGAGCTCAAGAAGGATG
-G--K--K--H--L--K--E--K--I--S--K--L--E--E--K--K--D--K--E--K--K--E--I--K--K--E--R--K--E--L--K--K--D--

----------------------------------------------------------------------------------------------------
E--G--R--K--E--E--K--K--D--A--K--K--E--E--K--R--K--D--T--K--P--E--L--K--K--I--S--K--P--D--L--K--P--F
AAGGAAGGAAGGAGGAGAAGAAGGATGCCAAGAAGGAGGAGAAGAGGAAAGATACCAAACCTGAGCTCAAGAAGATTTCCAAGCCAGACCTAAAGCCCTT
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::: ::::.:::.::::::::::::::::.::::::::
AAGGAAGGAAGGAGGAGAAGAAGGATGCCAAGAAGGAGGAGAAGAGGAAAGATACCAAGCCTGAGGTCAAAAAGGTTTCCAAGCCAGACCTGAAGCCCTT
E--G--R--K--E--E--K--K--D--A--K--K--E--E--K--R--K--D--T--K--P--E--V--K--K--V--S--K--P--D--L--K--P--F

----------------------------------------------------------------------------------------------------
--T--P--E--V--R--K--T--L--Y--K--A--K--V--P--G--R--V--K--I--D--R--S--R--A--I--R--G--E--K--E--L--S--S-
TACTCCTGAGGTACGTAAGACCCTCTATAAAGCCAAGGTCCCTGGAAGAGTCAAAATAGACAGGAGCCGTGCTATCCGTGGGGAGAAGGAGCTGTCTTCT
:::.::::::::. : :::::::::::.::::::::::.:::::  ::::::::.:..::::.:::::: :::..:::::::::::::::::::::::::
TACCCCTGAGGTGAGAAAGACCCTCTACAAAGCCAAGGCCCCTGCCAGAGTCAAGACGGACAAGAGCCGGGCTGCCCGTGGGGAGAAGGAGCTGTCTTCT
--T--P--E--V--R--K--T--L--Y--K--A--K--A--P--A--R--V--K--T--D--K--S--R--A--A--R--G--E--K--E--L--S--S-

----------------------------------------------------------------------------------------------------
-E--P--Q-----T--P--P--A--Q--K--G--T--V--P--L--P--T--I--S--G--H--R--E--L--V--L--S--S--P--E--D--L--T--
GAGCCCCAG---ACACCCCCAGCCCAGAAGGGAACTGTACCACTCCCAACCATCAGTGGGCACAGGGAGCTGGTCCTATCCTCACCAGAGGACCTCACAC
:::::::.    ::::::::::::::::::::..:::.::::::.::::: .::::::: :::::::::::::.::: ::.:: ::::::::.::::: :
GAGCCCCGCATGACACCCCCAGCCCAGAAGGGGGCTGCACCACTTCCAACAGTCAGTGGCCACAGGGAGCTGGCCCTTTCTTCTCCAGAGGATCTCACCC
-E--P--R--M--T--P--P--A--Q--K--G--A--A--P--L--P--T--V--S--G--H--R--E--L--A--L--S--S--P--E--D--L--T--

----------------------------------------------------------------------------------------------------
Q--D--F--E--E--M--K--R--E--E--R--A--L--L--A--E--Q--R--D--T--G--L--G--D--K--P--F--P--L--D--T--A--E--E
AGGACTTTGAGGAGATGAAGCGTGAGGAGAGGGCTTTGCTGGCTGAACAAAGGGACACAGGACTAGGAGATAAGCCATTCCCTCTAGACACTGCAGAGGA
:::::::::::::: ::::::::::::::::::  ::::::::::::::::::::::::::::::::::: ::.:::.: ::::. :::.::::::::::
AGGACTTTGAGGAGTTGAAGCGTGAGGAGAGGGGGTTGCTGGCTGAACAAAGGGACACAGGACTAGGAGAGAAACCACTGCCTCCCGACGCTGCAGAGGA
Q--D--F--E--E--L--K--R--E--E--R--G--L--L--A--E--Q--R--D--T--G--L--G--E--K--P--L--P--P--D--A--A--E--E

----------------------------------------------------------------------------------------------------
--G--P--P--S--T--A--I--Q--G--T--P--P--S--V--P--G--L--G--Q--E--E--H--V--M--K--E--K--E--L--V--P--E--V-
GGGACCCCCAAGTACAGCTATCCAGGGAACACCACCCTCTGTTCCAGGGCTGGGACAAGAAGAACATGTGATGAAGGAGAAAGAGCTTGTCCCAGAGGTC
::::::::::::.::::. ..:::.:..::::::::::::::.::::::::::.:: ::::::.: ::::::.:::::.:::::. :::::::::: .::
GGGACCCCCAAGCACAGTGGCCCAAGAGACACCACCCTCTGTCCCAGGGCTGGAACCAGAAGAGCCTGTGATAAAGGAAAAAGAAGTTGTCCCAGACATC
--G--P--P--S--T--V--A--Q--E--T--P--P--S--V--P--G--L--E--P--E--E--P--V--I--K--E--K--E--V--V--P--D--I-

----------------------------------------------------------------------------------------------------
-P--E--E--Q--G--S--K--D--R--G--L--D--S--G--A--E--T--E--E--E--K--D--T--W--E--E--K--K--Q--R--E--A--E--
CCTGAGGAACAAGGCAGCAAGGACAGAGGCCTAGACTCTGGGGCTGAAACAGAGGAAGAGAAAGATACCTGGGAGGAAAAGAAGCAGAGGGAAGCAGAGA
:::::::::: ::::::::::::::::::::.:::::::::.::::::::::::::.:::::::::::::::::::::::::::: .:.::::: ::::.
CCTGAGGAACCAGGCAGCAAGGACAGAGGCCCAGACTCTGGAGCTGAAACAGAGGAGGAGAAAGATACCTGGGAGGAAAAGAAGCCAAAGGAAGGAGAGG
-P--E--E--P--G--S--K--D--R--G--P--D--S--G--A--E--T--E--E--E--K--D--T--W--E--E--K--K--P--K--E--G--E--

----------------------------------------------------------------------------------------------------
R--L--P--D--R--T--E--A--R--E--E--S--E--P--E--V--K--E--D--V--I--E--K--A--E--L--E--E--M--E--E--V--H--P
GGCTCCCAGACAGAACAGAAGCCAGAGAGGAAAGTGAACCTGAAGTAAAGGAGGATGTGATAGAAAAGGCTGAGTTAGAAGAAATGGAGGAGGTACACCC
:::.::. :: ::::::::::::::::::::::::::::::::.::::::::::::::::::::.::::::::::::::::::::::::::: :.:::::
GGCCCCTTGAAAGAACAGAAGCCAGAGAGGAAAGTGAACCTGAGGTAAAGGAGGATGTGATAGAGAAGGCTGAGTTAGAAGAAATGGAGGAGCTGCACCC
G--P--L--E--R--T--E--A--R--E--E--S--E--P--E--V--K--E--D--V--I--E--K--A--E--L--E--E--M--E--E--L--H--P

----------------------------------------------------------------------------------------------------
--S--D--E--E--E--E--D--A--T--K--A--E--G--F--Y--Q--K--H--M--Q--E--P--L--K--V--T--P--R--S--R--E--A--F-
TTCAGATGAGGAGGAAGAGGACGCGACAAAAGCTGAGGGTTTTTACCAAAAACATATGCAGGAACCCTTGAAGGTAACTCCAAGGAGCCGGGAGGCTTTT
 :::::::::::::::::::: : ::::::.:::::::: ::::::::::::::::::::.::: ::::.:::::::::::::::.:: ::::::::.::
ATCAGATGAGGAGGAAGAGGAAGAGACAAAGGCTGAGGGATTTTACCAAAAACATATGCAAGAAGCCTTAAAGGTAACTCCAAGGGGCAGGGAGGCTCTT
--S--D--E--E--E--E--E--E--T--K--A--E--G--F--Y--Q--K--H--M--Q--E--A--L--K--V--T--P--R--G--R--E--A--L-

----------------------------------------------------------------------------------------------------
-G--G--R--E--L--G--L--Q--G--K--A--P--E--K--E--T--S--L--F--L--S--S--L--T--T--P--A--G--A--T--E--H--V--
GGGGGTCGGGAATTGGGACTCCAGGGCAAGGCCCCTGAGAAGGAGACCTCGTTATTCCTAAGCAGCCTGACCACACCTGCAGGAGCCACTGAGCATGTCT
:::::.::::::.:::::::.::.:::::::::::::::::::::.: ::.:.::::::::::::::::.:.:: ::::::::::::::::::::.::::
GGGGGCCGGGAACTGGGACTTCAAGGCAAGGCCCCTGAGAAGGAGGCGTCATCATTCCTAAGCAGCCTGGCTACCCCTGCAGGAGCCACTGAGCACGTCT
-G--G--R--E--L--G--L--Q--G--K--A--P--E--K--E--A--S--S--F--L--S--S--L--A--T--P--A--G--A--T--E--H--V--

----------------------------------------------------------------------------------------------------
S--Y--I--Q--D--E--T--I--P--G--Y--S--E--T--E--Q--T--I--S--D--E--E--I--H--D--E--P--E--E--R--P--A--P--P
CTTACATCCAGGATGAGACAATCCCTGGCTACTCAGAGACTGAGCAGACCATCTCAGATGAGGAGATCCATGATGAGCCGGAGGAGCGCCCAGCTCCACC
:::::::::::::.:::::.::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::
CTTACATCCAGGACGAGACGATCCCTGGCTACTCAGAGACCGAGCAGACCATCTCAGATGAGGAGATCCATGATGAGCCCGAGGAGCGCCCAGCTCCACC
S--Y--I--Q--D--E--T--I--P--G--Y--S--E--T--E--Q--T--I--S--D--E--E--I--H--D--E--P--E--E--R--P--A--P--P

----------------------------------------------------------------------------------------------------
--R--F--H--T--S--T--Y--D--L--P--G--P--E--G--A--G--P--F--E--A--S--Q--P--A--D--S--A--V--P--A--T--S--G-
CAGATTTCATACAAGTACATATGACCTGCCCGGGCCTGAAGGTGCTGGCCCATTCGAAGCCAGCCAACCTGCCGATAGTGCTGTTCCTGCTACCTCTGGC
.::.:::: .::..:::: :::::::: ::.:::::::::::: ::::: : ::.::.::.:::::.::::: :::.:::::::::..::.:::::.:::
TAGGTTTCCCACGGGTACCTATGACCTCCCTGGGCCTGAAGGTCCTGGCACCTTTGAGGCTAGCCAGCCTGCAGATGGTGCTGTTCTCGCCACCTCCGGC
--R--F--P--T--G--T--Y--D--L--P--G--P--E--G--P--G--T--F--E--A--S--Q--P--A--D--G--A--V--L--A--T--S--G-

----------------------------------------------------------------------------------------------------
-K--V--Y--G--T--P--E--T--E--L--T--Y--P--T--N--I--V--A--A--P--L--A--E--E--E--H--V--S--S--A--T--S--I--
AAAGTCTATGGAACGCCAGAGACTGAACTCACCTACCCCACTAACATAGTGGCTGCCCCTTTGGCTGAAGAGGAACATGTGTCCTCGGCCACTTCAATCA
:::. :::::::.::::::::::.::::::::::::::: :.:::::.::.:::::::::.:::::::::::::.::.::::::::.:::::.:::::::
AAAAGCTATGGAGCGCCAGAGACCGAACTCACCTACCCCCCCAACATGGTAGCTGCCCCTCTGGCTGAAGAGGAGCACGTGTCCTCAGCCACCTCAATCA
-K--S--Y--G--A--P--E--T--E--L--T--Y--P--P--N--M--V--A--A--P--L--A--E--E--E--H--V--S--S--A--T--S--I--

----------------------------------------------------------------------------------------------------
T--E--C--D--K--L--S--S--F--A--T--S--V--A--E--D--Q--S--V--A--S--L--T--A--P--Q--T--E--E--T--G--K--S--S
CTGAGTGTGACAAACTTTCTTCCTTTGCCACATCAGTGGCTGAGGACCAATCTGTGGCCTCACTTACAGCTCCCCAGACAGAGGAGACAGGCAAGAGCTC
:::::::::::::.                                                                                      
CTGAGTGTGACAAG--------------------------------------------------------------------------------------
T--E--C--D--K---------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--L--L--D--T--V--T--S--I--P--S--S--R--T--E--A--T--Q--G--L--D--Y--V--P--S--A--G--T--I--S--P--T--S-
CCTGCTGCTTGACACAGTCACAAGCATCCCTTCCTCCCGTACTGAAGCTACGCAGGGCTTGGACTATGTGCCATCAGCTGGTACCATCTCACCCACCTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--L--E--E--D--K--G--F--K--S--P--P--C--E--D--F--S--V--T--G--E--S--E--K--R--G--E--I--I--G--K--G--L--
TCACTGGAAGAAGACAAGGGCTTCAAATCACCACCCTGTGAGGACTTCTCTGTGACTGGGGAGTCAGAGAAGAGAGGAGAGATCATAGGGAAAGGCTTGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--G--E--R--A--V--E--E--E--E--E--E--T--A--N--V--E--M--S--E--K--L--C--S--Q--Y--G--T--P--V--F--S--A--P
CTGGAGAGAGAGCTGTGGAAGAGGAAGAGGAGGAGACAGCAAACGTAGAGATGTCTGAGAAACTTTGCAGTCAATATGGAACTCCAGTGTTTAGTGCCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--G--H--A--L--H--P--G--E--P--A--L--G--E--A--E--E--R--C--L--S--P--D--D--S--T--V--K--M--A--S--P--P--P-
TGGGCATGCCCTACATCCAGGAGAACCAGCCCTTGGAGAAGCAGAGGAGCGGTGCCTTAGCCCAGATGACAGCACAGTGAAGATGGCTTCTCCTCCACCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--G--P--P--S--A--T--H--T--P--F--H--Q--S--P--V--E--E--K--S--E--P--Q--D--F--Q--E--A--D--S--W--G--D--
TCTGGCCCACCCAGTGCCACCCACACACCCTTTCATCAGTCCCCAGTGGAAGAAAAGTCTGAGCCCCAAGACTTTCAGGAGGCAGACTCCTGGGGAGACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
T--K--R--T--P--G--V--G--K--E--D--A--A--E--E--T--V--K--P--G--P--E--E--G--T--L--E--K--E--E--K--V--P--P
CTAAGCGCACACCAGGTGTGGGCAAAGAAGATGCTGCTGAGGAGACAGTCAAGCCAGGGCCTGAAGAGGGCACACTAGAGAAGGAAGAGAAAGTTCCTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--R--S--P--Q--A--Q--E--A--P--V--N--I--D--E--G--L--T--G--C--T--I--Q--L--L--P--A--Q--D--K--A--I--V-
TCCCAGGAGCCCCCAGGCCCAGGAAGCACCTGTCAACATTGATGAGGGGCTTACAGGCTGTACCATTCAACTGTTGCCAGCACAGGATAAAGCAATAGTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-F--E--I--M--E--A--G--E--P--T--G--P--I--L--G--A--E--A--L--P--G--G--L--R--T--L--P--Q--E--P--G--K--P--
TTTGAGATTATGGAGGCAGGAGAGCCCACAGGCCCAATTCTGGGAGCAGAAGCCCTTCCCGGAGGTTTGAGGACTTTACCCCAAGAACCTGGCAAACCTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
Q--K--D--E--V--L--R--Y--P--D--R--S--L--S--P--E--D--A--E--S--L--S--V--L--S--V--P--S--P--D--T--A--N--Q
AGAAAGATGAGGTGCTCAGATATCCTGACCGAAGCCTCTCTCCTGAAGATGCAGAATCCCTCTCTGTCCTCAGCGTGCCCTCCCCAGACACTGCCAACCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--P--T--P--K--S--P--C--G--L--T--E--Q--Y--L--H--K--D--R--W--P--E--V--S--P--E--D--T--Q--S--L--S--L-
AGAGCCTACCCCCAAGTCTCCCTGTGGCCTGACAGAACAGTACCTACACAAAGACCGTTGGCCAGAGGTATCTCCAGAAGACACCCAGTCACTTTCTCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--E--E--S--P--S--K--E--T--S--L--D--V--S--S--K--Q--L--S--P--E--S--L--G--T--L--Q--F--G--E--L--N--L--
TCAGAAGAGAGTCCCAGCAAGGAGACCTCCCTGGATGTCTCTTCTAAGCAGCTCTCTCCAGAAAGCCTTGGCACCCTCCAGTTTGGGGAACTAAACCTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--K--E--E--M--G--H--L--M--Q--A--E--D--T--S--H--H--T--A--P--M--S--V--P--E--P--H--A--A--T--A--S--P--P
GGAAGGAAGAAATGGGGCATCTGATGCAGGCCGAGGATACCTCTCACCACACAGCTCCCATGTCTGTTCCAGAGCCCCATGCAGCCACAGCGTCACCTCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--T--D--G--T--T--R--Y--S--A--Q--T--D--I--T--D--D--S--L--D--R--K--S--P--A--S--S--F--S--H--S--T--P--S-
CACAGATGGGACAACTCGATACTCTGCACAGACAGACATCACAGATGACAGCCTTGACAGGAAGTCACCTGCCAGCTCATTCTCTCACTCTACACCTTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--N--G--K--Y--L--P--G--A--I--T--S--P--D--E--H--I--L--T--P--D--S--S--F--S--K--S--P--E--S--L--P--G--
GGAAATGGGAAGTACTTACCTGGGGCGATCACAAGCCCTGATGAACACATTCTGACACCTGATAGCTCCTTCTCCAAGAGTCCTGAGTCTTTGCCAGGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--A--L--E--D--I--A--I--K--W--E--D--K--V--P--G--L--K--D--R--T--S--E--Q--K--K--E--P--E--P--K--D--E--V
CTGCCTTGGAGGACATTGCCATAAAGTGGGAAGATAAAGTTCCAGGGTTGAAAGACAGAACCTCAGAACAGAAGAAGGAACCTGAGCCAAAGGATGAAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--Q--Q--K--D--K--T--L--E--H--K--E--V--V--E--P--K--D--T--A--I--Y--Q--K--D--E--A--L--H--V--K--N--E-
TTTACAGCAGAAAGACAAAACTCTGGAGCACAAGGAGGTGGTAGAGCCGAAGGATACAGCCATCTATCAGAAAGATGAGGCTCTGCATGTAAAGAATGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--V--K--Q--Q--D--K--A--L--E--Q--K--G--R--D--L--E--Q--K--D--T--A--L--E--Q--K--D--K--A--L--E--P--K--
GCTGTGAAACAGCAGGATAAGGCTTTAGAACAAAAGGGCAGAGACTTAGAGCAAAAAGACACAGCCCTAGAACAGAAGGACAAGGCCCTGGAACCAAAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--K--D--L--E--E--K--D--K--A--L--E--Q--K--D--K--I--P--E--E--K--D--K--A--L--E--Q--K--D--T--A--L--E--Q
ACAAAGACTTAGAAGAAAAAGACAAGGCCCTGGAACAGAAGGATAAGATTCCAGAAGAGAAAGACAAAGCCTTAGAACAAAAGGATACAGCCCTGGAACA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--K--D--K--A--L--E--P--K--D--K--D--L--E--Q--K--D--R--V--L--E--Q--K--E--K--I--P--E--E--K--D--K--A--L-
GAAGGACAAGGCCCTGGAACCAAAAGATAAAGACTTGGAACAAAAGGACAGGGTCCTAGAACAGAAGGAGAAGATCCCAGAAGAGAAAGACAAAGCCTTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-D--Q--K--V--R--S--V--E--H--K--A--P--E--D--T--V--A--E--M--K--D--R--D--L--E--Q--T--D--K--A--P--E--Q--
GATCAAAAAGTCAGAAGTGTTGAACATAAGGCTCCGGAGGACACGGTCGCTGAAATGAAGGACAGAGACCTAGAACAGACAGACAAAGCCCCTGAACAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--H--Q--A--Q--E--Q--K--D--K--V--S--E--K--K--D--Q--A--L--E--Q--K--Y--W--A--L--G--Q--K--D--E--A--L--E
AACACCAGGCCCAGGAACAAAAGGATAAAGTCTCAGAAAAGAAGGATCAGGCCTTAGAACAAAAATACTGGGCTTTGGGACAGAAGGATGAAGCCCTGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Q--N--I--Q--A--L--E--E--N--H--Q--T--Q--E--Q--E--S--L--V--Q--E--D--K--T--R--K--P--K--M--L--E--E--K-
ACAAAACATTCAGGCTCTGGAAGAGAACCACCAAACTCAGGAGCAGGAGAGCCTAGTGCAGGAGGATAAAACCAGGAAACCAAAGATGCTAGAGGAAAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--P--E--K--V--K--A--M--E--E--K--L--E--A--L--L--E--K--T--K--A--L--G--L--E--E--S--L--V--Q--E--G--R--
TCCCCAGAAAAGGTCAAGGCCATGGAAGAGAAGTTAGAAGCTCTTCTGGAGAAGACCAAAGCTCTGGGCCTGGAAGAGAGCCTAGTGCAGGAGGGCAGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--R--E--Q--E--E--K--Y--W--R--G--Q--D--V--V--Q--E--W--Q--E--T--S--P--T--R--E--E--P--A--G--E--Q--K--E
CCAGAGAGCAGGAAGAAAAGTACTGGAGGGGGCAGGATGTGGTCCAGGAGTGGCAAGAAACATCTCCTACCAGAGAGGAGCCGGCTGGAGAACAGAAAGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--A--P--A--W--E--D--T--S--P--E--Q--D--N--R--Y--W--R--G--R--E--D--V--A--L--E--Q--D--T--Y--W--R--E-
GCTTGCCCCGGCATGGGAGGACACATCTCCTGAGCAGGACAATAGGTATTGGAGGGGCAGAGAGGATGTGGCCTTGGAACAGGACACATACTGGAGGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--S--C--E--R--K--V--W--F--P--H--E--L--D--G--Q--G--A--R--P--H--Y--T--E--E--R--E--S--T--F--L--D--E--
CTAAGCTGTGAGCGGAAGGTCTGGTTCCCTCACGAGCTGGATGGCCAGGGGGCCCGCCCACACTACACTGAGGAACGGGAAAGCACTTTCCTAGATGAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--P--D--D--E--Q--E--V--P--L--R--E--H--A--T--R--S--P--W--A--S--D--F--K--D--F--Q--E--S--S--P--Q--K--G
GCCCAGATGATGAGCAAGAAGTACCCCTGCGGGAACACGCAACCCGGAGCCCCTGGGCCTCAGACTTCAAGGATTTCCAGGAATCCTCACCACAGAAGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--L--E--V--E--R--W--L--A--E--S--P--V--G--L--P--P--E--E--E--D--K--L--T--R--S--P--F--E--I--I--S--P--P-
GCTAGAGGTGGAGCGCTGGCTTGCTGAATCACCAGTTGGGTTGCCACCAGAGGAAGAGGACAAACTGACCCGCTCTCCCTTTGAGATCATCTCCCCTCCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--S--P--P--E--M--V--G--Q--R--V--P--S--A--P--G--Q--E--S--P--I--P--D--P--K--L--M--P--H--M--K--N--E--
GCTTCCCCACCTGAGATGGTTGGACAAAGGGTTCCTTCAGCCCCAGGACAAGAGAGTCCTATCCCAGACCCTAAGCTCATGCCACACATGAAGAATGAAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
P--T--T--P--S--W--L--A--D--I--P--P--W--V--P--K--D--R--P--L--P--P--A--P--L--S--P--A--P--G--P--P--T--P
CCACTACTCCCTCATGGCTGGCTGACATCCCACCCTGGGTGCCCAAGGACAGACCCCTCCCCCCTGCACCCCTCTCCCCAGCTCCTGGTCCCCCCACACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--P--E--S--H--T--P--A--P--F--S--W--G--T--A--E--Y--D--S--V--V--A--A--V--Q--E--G--A--A--E--L--E--G-
TGCCCCGGAATCCCATACTCCTGCACCCTTCTCTTGGGGCACAGCCGAGTATGACAGTGTGGTGGCTGCAGTGCAGGAGGGGGCAGCTGAGTTGGAAGGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--P--Y--S--P--L--G--K--D--Y--R--K--A--E--G--E--R--E--E--E--G--R--A--E--A--P--D--K--S--S--H--S--S--
GGGCCATACTCCCCCCTGGGGAAGGACTACCGCAAGGCTGAAGGGGAAAGGGAAGAAGAAGGTAGGGCTGAGGCTCCTGACAAAAGCTCACACAGCTCAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
K--V--P--E--A--S--K--S--H--A--T--T--E--P--E--Q--T--E--P--E--Q--R--E--P--T--P--Y--P--D--E--R--S--F--Q
AGGTACCAGAGGCCAGCAAAAGCCATGCCACCACGGAGCCTGAGCAGACTGAGCCGGAGCAGAGAGAGCCCACACCCTATCCTGATGAGAGAAGCTTTCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Y--A--D--I--Y--E--Q--M--M--L--T--G--L--G--P--A--C--P--T--R--E--P--P--L--G--A--A--G--D--W--P--P--C-
GTATGCAGACATCTATGAGCAGATGATGCTTACTGGGCTTGGCCCTGCATGCCCCACTAGAGAGCCTCCACTTGGAGCAGCTGGGGATTGGCCCCCATGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--S--T--K--E--A--A--A--G--R--N--T--S--A--E--K--E--L--S--S--P--I--S--P--K--S--L--Q--S--D--T--P--T--
CTCTCAACCAAGGAGGCAGCTGCCGGCCGAAACACATCTGCAGAGAAGGAGCTTTCATCTCCTATCTCACCCAAGAGCCTCCAGTCTGACACTCCAACCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
F--S--Y--A--A--L--A--G--P--T--V--P--P--R--P--E--P--G--P--S--M--E--P--S--L--T--P--P--A--V--P--P--R--A
TCAGCTATGCAGCCCTGGCAGGACCCACTGTACCCCCAAGGCCAGAGCCAGGGCCAAGTATGGAGCCCAGCCTCACCCCACCTGCAGTTCCCCCCCGTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--I--L--S--K--G--P--S--P--P--L--N--G--N--I--L--S--C--S--P--D--R--R--S--P--S--P--K--E--S--G--R--S-
TCCTATCCTGAGCAAAGGCCCAAGCCCCCCTCTTAATGGTAACATCCTGAGCTGCAGCCCAGATAGGAGGTCCCCATCCCCCAAGGAATCAGGCCGGAGT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-H--W--D--D--S--T--S--D--S--E--L--E--K--G--A--R--E--Q--P--E--K--E--A--Q--S--P--S--P--P--H--P--I--P--
CACTGGGATGACAGCACTAGTGACTCAGAACTGGAGAAGGGGGCTCGGGAACAGCCAGAAAAAGAGGCCCAATCCCCAAGTCCTCCTCACCCCATTCCTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
M--G--S--P--T--L--W--P--E--T--E--A--H--V--S--P--P--L--D--S--H--L--G--P--A--R--P--S--L--D--F--P--A--S
TGGGGTCCCCCACATTATGGCCAGAAACTGAGGCACATGTTAGCCCTCCCTTGGACTCACACCTGGGGCCTGCCCGACCCAGTCTGGACTTCCCTGCTTC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--A--F--G--F--S--S--L--Q--P--A--P--P--Q--L--P--S--P--A--E--P--R--S--A--P--C--G--S--L--A--F--S--G--D-
AGCCTTTGGCTTCTCCTCATTGCAGCCAGCTCCCCCACAGCTGCCCTCTCCAGCTGAACCCCGCTCGGCACCCTGTGGCTCCCTTGCCTTCTCTGGGGAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-R--A--L--A--L--A--P--G--P--P--T--R--T--R--H--D--E--Y--L--E--V--T--K--A--P--S--L--D--S--S--L--P--Q--
CGAGCTCTGGCTCTGGCTCCAGGACCCCCCACCAGAACCCGGCATGATGAATACCTGGAAGTGACCAAGGCCCCCAGCCTGGATTCCTCACTGCCCCAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--P--S--P--S--S--P--G--A--P--L--L--S--N--L--P--R--P--A--S--P--A--L--S--E--G--S--S--S--E--A--T--T--P
TCCCATCACCCAGTTCTCCTGGGGCCCCTCTCCTCTCCAATCTGCCACGACCTGCCTCACCAGCCCTGTCTGAGGGCTCCTCCTCTGAGGCTACCACGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--V--I--S--S--V--A--E--R--F--S--P--S--L--E--A--A--E--Q--E--S--G--E--L--D--P--G--M--E--P--A--A--H--S-
TGTGATTTCAAGTGTGGCGGAGCGCTTCTCTCCAAGCCTTGAGGCTGCAGAACAGGAGTCTGGAGAGCTGGACCCAGGAATGGAACCAGCTGCCCACAGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--W--D--L--T--P--L--S--P--A--P--P--A--S--L--D--L--A--L--A--P--A--P--S--L--P--G--D--M--G--D--G--I--
CTCTGGGACCTCACTCCTCTGAGCCCAGCACCCCCAGCTTCACTGGACTTGGCCCTAGCTCCAGCTCCAAGCCTGCCTGGAGACATGGGTGATGGCATCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
L--P--C--H--L--E--C--S--E--A--A--T--E--K--P--S--P--F--Q--V--P--S--E--D--C--A--A--N--G--P--T--E--T--S
TGCCGTGCCACCTGGAGTGCTCAGAGGCAGCCACGGAGAAGCCAAGCCCCTTCCAGGTTCCCTCTGAGGATTGTGCAGCCAATGGCCCAACTGAAACCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--P--N--P--P--G--P--A--P--A--K--A--E--N--E--E--A--A--A--C--P--A--W--E--R--G--A--W--P--E--G--A--E--R-
CCCTAACCCCCCAGGCCCTGCCCCAGCCAAGGCTGAAAATGAAGAGGCTGCGGCTTGCCCTGCCTGGGAACGTGGGGCCTGGCCTGAAGGAGCTGAGAGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-S--S--R--P--D--T--L--L--S--P--E--Q--P--V--C--P--A--G--G--S--G--G--P--P--S--S--A--S--P--E--V--E--A--
AGCTCCCGGCCTGACACATTGCTCTCCCCTGAGCAGCCAGTGTGTCCTGCAGGGGGCTCCGGGGGCCCACCCAGCAGTGCCTCTCCTGAGGTCGAAGCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--P--Q--G--C--A--T--E--P--R--P--H--R--G--E--L--S--P--S--F--L--N--P--P--L--P--P--S--I--D--D--R--D--L
GGCCCCAGGGATGTGCCACTGAGCCTCGGCCCCATCGTGGGGAGCTCTCCCCATCCTTCCTGAACCCACCTCTGCCCCCATCCATAGATGATAGGGACCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--S--T--E--E--V--R--L--V--G--R--G--G--R--R--R--V--G--G--P--G--T--T--G--G--P--C--P--V--T--D--E--T--P-
CTCAACTGAGGAAGTTCGGCTAGTAGGAAGAGGGGGGCGGCGCCGGGTAGGGGGGCCAGGGACCACTGGGGGCCCATGCCCTGTGACTGATGAGACACCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-P--T--S--A--S--D--S--G--S--S--Q--S--D--S--D--V--P--P--E--T--E--E--C--P--S--I--T--A--E--A--A--L--D--
CCTACATCAGCCAGTGACTCAGGCTCCTCACAGTCAGATTCTGATGTCCCGCCAGAAACTGAGGAGTGTCCGTCCATCACAGCTGAGGCAGCCCTCGACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
S--D--E--D--G--D--F--L--P--V--D--K--A--G--G--V--S--G--T--H--H--P--R--P--G--H--D--P--P--P--L--P--Q--P
CAGATGAAGATGGAGACTTCCTACCTGTGGACAAAGCTGGGGGTGTCAGTGGTACTCACCACCCCAGGCCTGGCCATGACCCACCTCCTCTCCCACAGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--D--P--R--P--S--P--P--R--P--D--V--C--M--A--D--P--E--G--L--S--S--E--S--G--R--V--E--R--L--R--E--K--E-
AGACCCCCGCCCATCCCCTCCCCGCCCTGATGTGTGCATGGCTGACCCCGAGGGGCTCAGCTCAGAGTCTGGGAGAGTAGAGAGGCTACGGGAGAAGGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-K--V--Q--G--R--V--G--R--R--A--P--G--K--A--K--P--A--S--P--A--R--R--L--D--L--R--G--K--R--S--P--T--P--
AAGGTTCAGGGGCGAGTAGGGCGCAGGGCCCCAGGCAAGGCCAAGCCAGCGTCCCCTGCACGGCGTCTGGATCTTCGGGGAAAACGCTCACCCACCCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--K--G--P--A--D--R--A--S--R--A--P--P--R--P--R--S--T--T--S--Q--V--T--P--A--E--E--K--D--G--H--S--P--M
GTAAAGGGCCTGCAGATCGAGCATCCCGGGCCCCACCTCGACCACGCAGCACCACAAGCCAGGTCACCCCAGCAGAGGAAAAGGATGGACACAGCCCCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------><-------------------------------------------------------------
--S--K--G--L--V--N--G--L--K--A--G--P--M--A--L--S--S--K--G--S--S--G--A--P--V--Y--V--D--L--A--Y--I--P-
GTCCAAAGGCCTAGTCAATGGACTCAAGGCAGGACCAATGGCCTTGAGTTCCAAGGGCAGCTCTGGTGCCCCTGTATATGTGGATCTCGCCTACATCCCG
                                                                                                 :::
-------------------------------------------------------------------------------------------------CCG
--------------------------------------------------------------------------------------------------P-

----------------------------------------------------------------------------------------------------
-N--H--C--S--G--K--T--A--D--L--D--F--F--R--R--V--R--A--S--Y--Y--V--V--S--G--N--D--P--A--N--G--E--P--
AATCATTGCAGTGGCAAGACTGCTGACCTTGACTTCTTCCGTCGAGTGCGTGCATCCTACTATGTGGTCAGTGGGAATGACCCTGCCAATGGCGAGCCAA
::::::  ::::::::::::::::::::::::::::: ::: ::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:
AATCATGCCAGTGGCAAGACTGCTGACCTTGACTTCTACCGACGAGTGCGTGCATCCTACTATGTGGTCAGTGGGAATGACCCTGCCAATGGCGAGCCGA
-N--H--A--S--G--K--T--A--D--L--D--F--Y--R--R--V--R--A--S--Y--Y--V--V--S--G--N--D--P--A--N--G--E--P--

--------------------------------------------------------------><><----------------------------------
S--R--A--V--L--D--A--L--L--E--G--K--A--Q--W--G--E--N--L--Q--V--I--V--T--L--I--P--T--H--D--T--E--V--T
GCCGGGCTGTGCTGGATGCCCTGCTGGAGGGCAAGGCCCAGTGGGGGGAGAATCTTCAGGTGATAGTGACTCTGATCCCTACTCATGACACGGAGGTGAC
::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::   :::::::: :::::::::::::::::.::::::::
GCCGGGCTGTGCTGGATGCCCTGCTGGAGGGCAAGGCCCAGTGGGGGGAGAATCTTCAGGTG---GTGACTCTCATCCCTACTCATGACACAGAGGTGAC
S--R--A--V--L--D--A--L--L--E--G--K--A--Q--W--G--E--N--L--Q--V-----V--T--L--I--P--T--H--D--T--E--V--T

----------------------------------------------------------------------------------------------------
--R--E--W--Y--Q--Q--T--H--E--Q--Q--Q--Q--L--N--V--L--V--L--A--S--S--S--T--V--V--M--Q--D--E--S--F--P-
TCGTGAGTGGTACCAACAAACTCATGAGCAGCAGCAACAACTGAATGTCCTGGTCCTGGCTAGCAGCAGCACCGTGGTGATGCAGGATGAGTCCTTCCCT
:::::::::::::::.::.::::::::::::::::::::::::::.::.::::::::::::::::::::::::::::: :::::::::::::::::::: 
TCGTGAGTGGTACCAGCAGACTCATGAGCAGCAGCAACAACTGAACGTTCTGGTCCTGGCTAGCAGCAGCACCGTGGTCATGCAGGATGAGTCCTTCCCG
--R--E--W--Y--Q--Q--T--H--E--Q--Q--Q--Q--L--N--V--L--V--L--A--S--S--S--T--V--V--M--Q--D--E--S--F--P-

-------------------->
-A--C--K--I--E--F--*-
GCCTGCAAGATTGAGTTCTGA
:::::::::::::::::::::
GCCTGCAAGATTGAGTTCTGA
-A--C--K--I--E--F--*-

Pig Consensus Sequence

>BGISUST0000885979
ATGGATGGCGTGGCTGAGTTCTCCGAGTATGTCTCTGAGACTGTGGACGTGCCATCCCCCTTTGACCTGCTTGAGCCCCCCACCTCAGGGGGCTTCCTCA
AGCTCTCCAAGCCTTGCTGCTACATCTTCCCCGGCGGCCGAGGGGACTCTGCCCTCTTTGCTGTTAATGGTTTCAACATCCTGGTGGATGGTGGCTCTGA
TCGCAAGTCCTGCTTCTGGAAGCTGGTGCGGCACCTAGATCGCATTGACTCGGTTTTACTCACCCACATCGGGGCAGACAACCTGCCAGGCATCAACGGA
CTCCTACAGCGCAAAGTGGCAGAACTGGAGGAGGAGCAGTCCCAGGGCTCCAGCAGCTACAGCGACTGGGTGAAGAACCTCATCTCCCCTGAGCTTGGAG
TTGTCTTCTTTAACGTGCCCGATAAGCTGCGGCTGCCTGATGCCTCCCGGAAGGCCAAGCGCAGCATTGAGGAGGCCTGCCTCACTCTGCAGCACCTGAA
CCGTCTGGGCATCCAGGCCGAGCCACTGTACCGTGTGGTCAGCAACACCATTGAGCCACTGACCCTCTTCCACAAAATGGGTGTGGGCCGGCTGGACATG
TATGTCCTCAACCCGGTCAAAGACAGCAAGGAGATGCAGTTCCTCATGCAAAAGTGGGCAGGCAACAGTAAAGCTAAGACAGGCATCGTGCTGGCTAATG
GGAAGGAGGCTGAGATCTCCGTGCCTTACCTGACCTCAATCACTGCTCTGGTGGTCTGGCTACCAGCCAACCCCACCGAGAAGATTGTGCGTGTGCTTTT
TCCAGGGAATGCTCCCCAGAACAAGATCTTGGAGGGCCTGGAAAAGCTTCGGCATCTGGACTTCCTGCGCTACCCCGTGGCCACGCAGAAGGACCTGGCC
ACTGGGGCTGTGCCTGCCAACCTCAAACCCAGCAAAATCAAACAGCGGGCTGATAGCAAGGAAAGCCTCAAGGCCACAACCAAGACAGCTGTGAGCAAGC
TGGCCAAACGGGAGGAGGTGGCCGAAGAGGGAGCCAAGGAGGCCCGCTCAGAACTAGCCAAGGAATTAGCCAAGACAGAGAAGAAGGCAAAAGAGTCATC
TGAGAAGCCCCCAGAGAAGCCTGCCAAGCCTGAGAGGGTGAAGACAGAGTCGAGTGAGGCACTGAAGGCAGAGAAGCGAAAGCTGATCAAAGACAAGGTG
GGGAAGAAGCACCTGAAAGAAAAGATTTCAAAGCTGGAAGAAAAAAAAGACAAAGAGAAAAAAGAAATCAAGAAGGAGAGGAAGGAGCTCAAGAAGGATG
AAGGAAGGAAGGAGGAGAAGAAGGATGCCAAGAAGGAGGAGAAGAGGAAAGATACCAAGCCTGAGGTCAAAAAGGTTTCCAAGCCAGACCTGAAGCCCTT
TACCCCTGAGGTGAGAAAGACCCTCTACAAAGCCAAGGCCCCTGCCAGAGTCAAGACGGACAAGAGCCGGGCTGCCCGTGGGGAGAAGGAGCTGTCTTCT
GAGCCCCGCATGACACCCCCAGCCCAGAAGGGGGCTGCACCACTTCCAACAGTCAGTGGCCACAGGGAGCTGGCCCTTTCTTCTCCAGAGGATCTCACCC
AGGACTTTGAGGAGTTGAAGCGTGAGGAGAGGGGGTTGCTGGCTGAACAAAGGGACACAGGACTAGGAGAGAAACCACTGCCTCCCGACGCTGCAGAGGA
GGGACCCCCAAGCACAGTGGCCCAAGAGACACCACCCTCTGTCCCAGGGCTGGAACCAGAAGAGCCTGTGATAAAGGAAAAAGAAGTTGTCCCAGACATC
CCTGAGGAACCAGGCAGCAAGGACAGAGGCCCAGACTCTGGAGCTGAAACAGAGGAGGAGAAAGATACCTGGGAGGAAAAGAAGCCAAAGGAAGGAGAGG
GGCCCCTTGAAAGAACAGAAGCCAGAGAGGAAAGTGAACCTGAGGTAAAGGAGGATGTGATAGAGAAGGCTGAGTTAGAAGAAATGGAGGAGCTGCACCC
ATCAGATGAGGAGGAAGAGGAAGAGACAAAGGCTGAGGGATTTTACCAAAAACATATGCAAGAAGCCTTAAAGGTAACTCCAAGGGGCAGGGAGGCTCTT
GGGGGCCGGGAACTGGGACTTCAAGGCAAGGCCCCTGAGAAGGAGGCGTCATCATTCCTAAGCAGCCTGGCTACCCCTGCAGGAGCCACTGAGCACGTCT
CTTACATCCAGGACGAGACGATCCCTGGCTACTCAGAGACCGAGCAGACCATCTCAGATGAGGAGATCCATGATGAGCCCGAGGAGCGCCCAGCTCCACC
TAGGTTTCCCACGGGTACCTATGACCTCCCTGGGCCTGAAGGTCCTGGCACCTTTGAGGCTAGCCAGCCTGCAGATGGTGCTGTTCTCGCCACCTCCGGC
AAAAGCTATGGAGCGCCAGAGACCGAACTCACCTACCCCCCCAACATGGTAGCTGCCCCTCTGGCTGAAGAGGAGCACGTGTCCTCAGCCACCTCAATCA
CTGAGTGTGAC-----------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------CCGAAT
CATGCCAGTGGCAAGACTGCTGACCTTGACTTCTACCGACGAGTGCGTGCATCCTACTATGTGGTCAGTGGGAATGACCCTGCCAATGGCGAGCCGAGCC
GGGCTGTGCTGGATGCCCTGCTGGAGGGCAAGGCCCAGTGGGGGGAGAATCTTCAGGTG---GTGACTCTCATCCCTACTCATGACACAGAGGTGACTCG
TGAGTGGTACCAGCAGACTCATGAGCAGCAGCAACAACTGAACGTTCTGGTCCTGGCTAGCAGCAGCACCGTGGTCATGCAGGATGAGTCCTTCCCGGCC
TGCAAGATTGAGTTCTGA


>BGISUSP0000885979
MDGVAEFSEYVSETVDVPSPFDLLEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGFNILVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGING
LLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFFNVPDKLRLPDASRKAKRSIEEACLTLQHLNRLGIQAEPLYRVVSNTIEPLTLFHKMGVGRLDM
YVLNPVKDSKEMQFLMQKWAGNSKAKTGIVLANGKEAEISVPYLTSITALVVWLPANPTEKIVRVLFPGNAPQNKILEGLEKLRHLDFLRYPVATQKDLA
TGAVPANLKPSKIKQRADSKESLKATTKTAVSKLAKREEVAEEGAKEARSELAKELAKTEKKAKESSEKPPEKPAKPERVKTESSEALKAEKRKLIKDKV
GKKHLKEKISKLEEKKDKEKKEIKKERKELKKDEGRKEEKKDAKKEEKRKDTKPEVKKVSKPDLKPFTPEVRKTLYKAKAPARVKTDKSRAARGEKELSS
EPRMTPPAQKGAAPLPTVSGHRELALSSPEDLTQDFEELKREERGLLAEQRDTGLGEKPLPPDAAEEGPPSTVAQETPPSVPGLEPEEPVIKEKEVVPDI
PEEPGSKDRGPDSGAETEEEKDTWEEKKPKEGEGPLERTEAREESEPEVKEDVIEKAELEEMEELHPSDEEEEEETKAEGFYQKHMQEALKVTPRGREAL
GGRELGLQGKAPEKEASSFLSSLATPAGATEHVSYIQDETIPGYSETEQTISDEEIHDEPEERPAPPRFPTGTYDLPGPEGPGTFEASQPADGAVLATSG
KSYGAPETELTYPPNMVAAPLAEEEHVSSATSITECD---------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------------------------------------------PN
HASGKTADLDFYRRVRASYYVVSGNDPANGEPSRAVLDALLEGKAQWGENLQV-VTLIPTHDTEVTREWYQQTHEQQQQLNVLVLASSSTVVMQDESFPA
CKIEF*