Sequences
EST Library Info
cad1Unavailable
cov2Ovary - RNA from China
ecc2Foetus 50 days, cortex cerebri
jej2Small intestine, jejunum
med2Mediastinum
nep1Newborn 115 days, epidermis
pgl1Pituitary gland
pigcb1Unavailable
plac5Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000167257 (click for geneview)
Transcript ID ENST00000300650(link to ensembl)
Symbol NP_997226.1
Localtion Chromosome:11:116610190:116661263:1 band: 11q23.3
Description hypothetical protein DKFZp547C195
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------------><------------------------
-M--S--I--W--S--T--Q--S--R--I--L--V--H--Q--Q--V--T--P--Q--Q--R--T--R--W--F--G--E--N--L--I--A--T--A--
ATGTCCATTTGGAGCACTCAGAGCAGAATCCTGGTTCATCAGCAGGTGACACCTCAGCAGCGCACCAGGTGGTTTGGAGAAAACTTGATAGCCACAGCCC
:::.::: ::::::::::::::::::::::::::::::::.::::::::.::.:: ::::::::::..:..::::::::::::::::::.:::::.::::
ATGCCCAATTGGAGCACTCAGAGCAGAATCCTGGTTCATCGGCAGGTGATACTTCTGCAGCGCACCGAGCAGTTTGGAGAAAACTTGATGGCCACGGCCC
-M--P--N--W--S--T--Q--S--R--I--L--V--H--R--Q--V--I--L--L--Q--R--T--E--Q--F--G--E--N--L--M--A--T--A--

----------------------------------------------------------------------------------------------------
L--C--L--S--G--S--G--S--Q--S--D--L--K--D--V--A--S--T--A--G--E--E--G--D--T--S--L--R--E--S--L--H--P--V
TTTGTCTTTCTGGCAGTGGGTCTCAGTCTGATTTGAAGGATGTGGCCAGCACAGCAGGAGAGGAGGGGGACACAAGCCTTCGGGAGAGCCTCCATCCAGT
:.:::::.::::::.::::::::::::::::::.::::::..::::::.::::::::::::::::::::::::. ::::.::.:::::::..::.:: : 
TCTGTCTCTCTGGCGGTGGGTCTCAGTCTGATTCGAAGGACATGGCCAACACAGCAGGAGAGGAGGGGGACACGTGCCTCCGAGAGAGCCCTCACCCTGG
L--C--L--S--G--G--G--S--Q--S--D--S--K--D--M--A--N--T--A--G--E--E--G--D--T--C--L--R--E--S--P--H--P--G

----------------------------------------------------------------------------------------------------
--T--R--S--L--K--A--G--C--H--T--K--Q--L--A--S--R--N--C--S--E--E--K--S--P--Q--T--S--I--L--K--E--G--N-
CACTCGGTCTCTTAAGGCAGGGTGCCATACTAAGCAGCTTGCCTCCAGGAATTGCTCTGAAGAGAAATCCCCACAAACCTCCATCCTAAAGGAAGGTAAC
:::::::::::::::::::::::::::::: :::::::.:::::::.:::::::..::::::::::. ::::::::.:::::.::::::::::::: :.:
CACTCGGTCTCTTAAGGCAGGGTGCCATACAAAGCAGCCTGCCTCCGGGAATTGTCCTGAAGAGAAGGCCCCACAAGCCTCCGTCCTAAAGGAAGGGAGC
--T--R--S--L--K--A--G--C--H--T--K--Q--P--A--S--G--N--C--P--E--E--K--A--P--Q--A--S--V--L--K--E--G--S-

----------------------------------------------------------------------------------------------------
-R--D--T--S--L--D--F--R--P--V--V--S--P--A--N--G--V--E--G--V--R--V--D--Q--D--D--D--Q--D--S--S--S--L--
AGGGACACAAGCTTGGATTTCCGACCTGTAGTGTCTCCAGCAAATGGGGTTGAAGGAGTCCGAGTGGATCAGGATGATGATCAAGATAGCTCTTCCCTGA
:::::::::.::::::::::::::::.::::::.:::::::::::::::::::::::::: ::::::: ::::::::::::::.::::::::::::::::
AGGGACACAGGCTTGGATTTCCGACCCGTAGTGCCTCCAGCAAATGGGGTTGAAGGAGTCAGAGTGGAACAGGATGATGATCAGGATAGCTCTTCCCTGA
-R--D--T--G--L--D--F--R--P--V--V--P--P--A--N--G--V--E--G--V--R--V--E--Q--D--D--D--Q--D--S--S--S--L--

-------------------------><----------------------------------------------------------><-------------
K--L--S--Q--N--I--A--V--Q--T--D--F--K--T--A--D--S--E--V--N--T--D--Q--D--I--E--K--N--L--D--K--M--M--T
AGCTTTCTCAGAACATTGCTGTACAGACTGACTTTAAGACAGCTGATTCAGAGGTAAACACAGATCAAGATATTGAAAAGAATTTGGATAAAATGATGAC
:::::::::::::::::::::: :::::::::::::::::.:: :::::::::::::::::::::::::::::::::::::::.::::::::::::::::
AGCTTTCTCAGAACATTGCTGTCCAGACTGACTTTAAGACGGCAGATTCAGAGGTAAACACAGATCAAGATATTGAAAAGAATCTGGATAAAATGATGAC
K--L--S--Q--N--I--A--V--Q--T--D--F--K--T--A--D--S--E--V--N--T--D--Q--D--I--E--K--N--L--D--K--M--M--T

----------------------------------------------------------------------------------------------------
--E--R--T--L--L--K--E--R--Y--Q--E--V--L--D--K--Q--R--Q--V--E--N--Q--L--Q--V--Q--L--K--Q--L--Q--Q--R-
AGAGAGAACCCTGTTGAAAGAGCGTTACCAGGAGGTCCTGGACAAACAGAGGCAAGTGGAGAATCAGCTCCAAGTGCAATTAAAGCAGCTTCAGCAAAGG
::::::::::::::::::.::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::.::::::::::::
AGAGAGAACCCTGTTGAAGGAGCGTTACCAGGAGGTCCTGGACAAGCAGAGGCAAGTGGAGAATCAGCTCCAAGTGCAATTAAAGCAACTTCAGCAAAGG
--E--R--T--L--L--K--E--R--Y--Q--E--V--L--D--K--Q--R--Q--V--E--N--Q--L--Q--V--Q--L--K--Q--L--Q--Q--R-

--------------------------><------------------------------------------------------------------------
-R--E--E--E--M--K--N--H--Q--E--I--L--K--A--I--Q--D--V--T--I--K--R--E--E--T--K--K--K--I--E--K--E--K--
AGAGAAGAGGAAATGAAGAATCACCAGGAGATATTAAAGGCTATTCAGGATGTGACAATAAAGCGGGAAGAAACAAAGAAGAAGATAGAGAAAGAGAAGA
::::::::.:::::::::::::::::::::::::::::::::::.::::::::.:::::::::::.::::::::.::::::::::::::::::::.::::
AGAGAAGAAGAAATGAAGAATCACCAGGAGATATTAAAGGCTATCCAGGATGTAACAATAAAGCGAGAAGAAACGAAGAAGAAGATAGAGAAAGAAAAGA
-R--E--E--E--M--K--N--H--Q--E--I--L--K--A--I--Q--D--V--T--I--K--R--E--E--T--K--K--K--I--E--K--E--K--

------------------------------------------------------------------><--------------------------------
K--E--F--L--Q--K--E--Q--D--L--K--A--E--I--E--K--L--C--E--K--G--R--R--E--V--W--E--M--E--L--D--R--L--K
AGGAGTTTTTGCAGAAGGAGCAGGATCTGAAAGCTGAAATTGAGAAGCTTTGTGAGAAGGGCAGAAGAGAGGTGTGGGAAATGGAACTGGATAGACTCAA
:::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::: ::::   ::.:::::::::::::::::::::::::::::
AGGAGTTTTTGCAGAAGGAACAGGATCTGAAAGCTGAAATTGAGAAGCTTTGTGAGAAGGCCAGA---GAAGTGTGGGAAATGGAACTGGATAGACTCAA
K--E--F--L--Q--K--E--Q--D--L--K--A--E--I--E--K--L--C--E--K--A--R-----E--V--W--E--M--E--L--D--R--L--K

---------------------------------------------------------------><-----------------------------------
--N--Q--D--G--E--I--N--R--N--I--M--E--E--T--E--R--A--W--K--A--E--I--L--S--L--E--S--R--K--E--L--L--V-
GAATCAGGATGGCGAAATAAATAGGAACATTATGGAAGAGACTGAACGGGCCTGGAAGGCAGAGATCTTATCACTAGAGAGCCGGAAAGAGTTACTGGTA
:::::::::::::::::::::: :::::::::::::.::::: :::::::::::::::::::::::.::::::::::::::.:::::::::::.::::::
GAATCAGGATGGCGAAATAAATCGGAACATTATGGAGGAGACAGAACGGGCCTGGAAGGCAGAGATTTTATCACTAGAGAGTCGGAAAGAGTTGCTGGTA
--N--Q--D--G--E--I--N--R--N--I--M--E--E--T--E--R--A--W--K--A--E--I--L--S--L--E--S--R--K--E--L--L--V-

----------------------------------------------------><----------------------------------------------
-L--K--L--E--E--A--E--K--E--A--E--L--H--L--T--Y--L--K--S--T--P--P--T--L--E--T--V--R--S--K--Q--E--W--
CTGAAACTAGAAGAAGCAGAAAAAGAGGCAGAATTGCACCTTACTTACCTCAAGTCAACTCCCCCAACACTGGAGACAGTTCGTTCCAAACAGGAGTGGG
.::::::::::::::::::::::::::::::::.:::::::::::::::::   :::::::::::.:::::.:::::::::::::::::::::::.::::
TTGAAACTAGAAGAAGCAGAAAAAGAGGCAGAACTGCACCTTACTTACCTC---TCAACTCCCCCGACACTAGAGACAGTTCGTTCCAAACAGGAATGGG
-L--K--L--E--E--A--E--K--E--A--E--L--H--L--T--Y--L-----S--T--P--P--T--L--E--T--V--R--S--K--Q--E--W--

-------------------------------------------><-------------------------------------------------------
E--T--R--L--N--G--V--R--I--M--K--K--N--V--R--D--Q--F--N--S--H--I--Q--L--V--R--N--G--A--K--L--S--S--L
AGACGAGACTGAATGGAGTTCGGATAATGAAAAAGAATGTTCGTGACCAATTTAATAGTCATATCCAGTTAGTGAGGAACGGAGCCAAGCTGAGCAGCCT
::::.:::::::::::::::::.::::::::::::::::::   :::::.::::::::::::::::::.:::::::::::::::::::::::::::::::
AGACAAGACTGAATGGAGTTCGAATAATGAAAAAGAATGTT---GACCAGTTTAATAGTCATATCCAGCTAGTGAGGAACGGAGCCAAGCTGAGCAGCCT
E--T--R--L--N--G--V--R--I--M--K--K--N--V-----D--Q--F--N--S--H--I--Q--L--V--R--N--G--A--K--L--S--S--L

------------------------------------------><--------------------------------------------------------
--P--Q--I--P--T--P--T--L--P--P--P--P--S--E--T--D--F--M--L--Q--V--F--Q--P--S--P--S--L--A--P--R--M--P-
TCCTCAAATCCCTACTCCCACTTTACCTCCACCCCCATCAGAGACAGACTTCATGCTTCAGGTGTTTCAACCCAGTCCCTCTCTGGCTCCTCGGATGCCC
::::::.:::::::::::::::::.:::::::::::.:::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::
TCCTCAGATCCCTACTCCCACTTTGCCTCCACCCCCGTCAGAGACAGACTTCATGCTTCAGGTGTTTCAACCCAATCCCTCTCTGGCTCCTCGGATGCCC
--P--Q--I--P--T--P--T--L--P--P--P--P--S--E--T--D--F--M--L--Q--V--F--Q--P--N--P--S--L--A--P--R--M--P-

----------------------------------------------------------------------------------------------------
-F--S--I--G--Q--V--T--M--P--M--V--M--P--S--A--D--P--R--S--L--S--F--P--I--L--N--P--A--L--S--Q--P--S--
TTCTCCATTGGGCAGGTCACAATGCCCATGGTTATGCCCAGTGCAGATCCCCGCTCCTTGTCTTTCCCAATCCTGAACCCTGCCCTTTCCCAGCCCAGCC
:::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::.::
TTCTCCATTGGGCAGGTCACAATGCCCATGGTTATGCCCAGTGCAGATCCCCGTTCCTTGTCTTTCCCAATCCTGAACCCTGCCCTTTCCCAGCCCAACC
-F--S--I--G--Q--V--T--M--P--M--V--M--P--S--A--D--P--R--S--L--S--F--P--I--L--N--P--A--L--S--Q--P--N--

----------------------------------------------------------------------------------------------------
Q--P--S--S--P--L--P--G--S--H--G--R--N--S--P--G--L--G--S--L--V--S--P--H--G--P--H--M--P--P--A--A--S--I
AGCCTTCCTCACCCCTTCCTGGCTCCCATGGCAGAAATAGCCCTGGCTTGGGTTCCCTTGTCAGCCCCCACGGTCCACACATGCCCCCTGCCGCCTCCAT
::::::::.:::::::::::::::::::::: :::::.:::::.::::::::::::::::::.: :::::.::::::::..:::::::.:::::::::::
AGCCTTCCCCACCCCTTCCTGGCTCCCATGGGAGAAACAGCCCCGGCTTGGGTTCCCTTGTCGGGCCCCATGGTCCACATGTGCCCCCCGCCGCCTCCAT
Q--P--S--P--P--L--P--G--S--H--G--R--N--S--P--G--L--G--S--L--V--G--P--H--G--P--H--V--P--P--A--A--S--I

----------------------------------------------------------------------------------------------------
--P--P--P--P--G--L--G--G--V--K--A--S--A--E--T--P--R--P--Q--P--V--D--K--L--E--K--I--L--E--K--L--L--T-
CCCACCTCCCCCAGGCTTGGGCGGTGTTAAGGCTTCTGCTGAAACTCCCCGGCCCCAACCAGTAGACAAACTGGAGAAGATCCTGGAGAAGCTGCTGACC
::::::::::::::::.::::.:::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::
CCCACCTCCCCCAGGCCTGGGTGGTGTTAAGGCTTCTACTGAAACTCCCCGGCCCCAACCAGTAGACAAACTGGAGAAGATTCTGGAGAAGCTGCTGACC
--P--P--P--P--G--L--G--G--V--K--A--S--T--E--T--P--R--P--Q--P--V--D--K--L--E--K--I--L--E--K--L--L--T-

-------------------><-------------------------------------------------------------------------------
-R--F--P--Q--C--N--K--A--Q--M--T--N--I--L--Q--Q--I--K--T--A--R--T--T--M--A--G--L--T--M--E--E--L--I--
CGGTTCCCACAGTGCAATAAGGCCCAGATGACCAACATTCTTCAGCAGATCAAGACAGCACGTACCACCATGGCAGGCCTGACCATGGAGGAACTTATCC
:::::::::::.::::::   :::::::::::::::::.::::::::.:::::::::::::::::::::::::::::.::.:::::::::::::: ::::
CGGTTCCCACAATGCAAT---GCCCAGATGACCAACATCCTTCAGCAAATCAAGACAGCACGTACCACCATGGCAGGTCTAACCATGGAGGAACTGATCC
-R--F--P--Q--C--N-----A--Q--M--T--N--I--L--Q--Q--I--K--T--A--R--T--T--M--A--G--L--T--M--E--E--L--I--

----------------------------------------------------><----------------------------------------------
Q--L--V--A--A--R--L--A--E--H--E--R--V--A--A--S--T--Q--P--L--G--R--I--R--A--L--F--P--A--P--L--A--Q--I
AGTTGGTTGCTGCACGACTGGCAGAACATGAGCGGGTGGCAGCAAGTACTCAGCCACTTGGTCGCATCCGGGCCTTGTTCCCTGCTCCACTGGCCCAAAT
::::::: ::::::::.::::::::.:::::::::::::::::::::::::::::::::::::: ::::::::::::::::::::::::.::::::::::
AGTTGGTAGCTGCACGGCTGGCAGAGCATGAGCGGGTGGCAGCAAGTACTCAGCCACTTGGTCGGATCCGGGCCTTGTTCCCTGCTCCATTGGCCCAAAT
Q--L--V--A--A--R--L--A--E--H--E--R--V--A--A--S--T--Q--P--L--G--R--I--R--A--L--F--P--A--P--L--A--Q--I

---------------------------------------------------------><-----------------------------------------
--S--T--P--M--F--L--P--S--A--Q--V--S--Y--P--G--R--S--S--H--A--P--A--T--C--K--L--C--L--M--C--Q--K--L-
CAGTACCCCAATGTTCTTGCCTTCTGCCCAAGTTTCATATCCTGGAAGGTCTTCACATGCTCCAGCCACCTGTAAGCTATGTCTAATGTGCCAGAAACTC
:::::::::::::::::::::::::::::::::::::::::::::.::::::::::::            ::::::::.::::: ::::::::::::::.
CAGTACCCCAATGTTCTTGCCTTCTGCCCAAGTTTCATATCCTGGGAGGTCTTCACAT------------TGTAAGCTGTGTCTCATGTGCCAGAAACTT
--S--T--P--M--F--L--P--S--A--Q--V--S--Y--P--G--R--S--S--H--------------C--K--L--C--L--M--C--Q--K--L-

-----------------------------------------------------><---------------------------------------------
-V--Q--P--S--E--L--H--P--M--A--C--T--H--V--L--H--K--E--C--I--K--F--W--A--Q--T--N--T--N--D--T--C--P--
GTCCAGCCCAGTGAGCTGCATCCAATGGCGTGTACCCATGTATTGCACAAGGAGTGTATCAAATTCTGGGCCCAGACCAACACAAATGACACTTGTCCCT
:::::::::::::::::::::::::::::.::::::::.::..:::::::::::::::::::::::::::::::::::::::::::::::::::::::::
GTCCAGCCCAGTGAGCTGCATCCAATGGCATGTACCCACGTGCTGCACAAGGAGTGTATCAAATTCTGGGCCCAGACCAACACAAATGACACTTGTCCCT
-V--Q--P--S--E--L--H--P--M--A--C--T--H--V--L--H--K--E--C--I--K--F--W--A--Q--T--N--T--N--D--T--C--P--

------------------->
F--C--P--T--L--K--*-
TTTGTCCAACTCTTAAATGA
::::::::::::::::::::
TTTGTCCAACTCTTAAATGA
F--C--P--T--L--K--*-

Pig Consensus Sequence

>BGISUST0000895293
ATGCCCAATTGGAGCACTCAGAGCAGAATCCTGGTTCATCGGCAGGTGATACTTCTGCAGCGCACCGAGCAGTTTGGAGAAAACTTGATGGCCACGGCCC
TCTGTCTCTCTGGCGGTGGGTCTCAGTCTGATTCGAAGGACATGGCCAACACAGCAGGAGAGGAGGGGGACACGTGCCTCCGAGAGAGCCCTCACCCTGG
CACTCGGTCTCTTAAGGCAGGGTGCCATACAAAGCAGCCTGCCTCCGGGAATTGTCCTGAAGAGAAGGCCCCACAAGCCTCCGTCCTAAAGGAAGGGAGC
AGGGACACAGGCTTGGATTTCCGACCCGTAGTGCCTCCAGCAAATGGGGTTGAAGGAGTCAGAGTGGAACAGGATGATGATCAGGATAGCTCTTCCCTGA
AGCTTTCTCAGAACATTGCTGTCCAGACTGACTTTAAGACGGCAGATTCAGAGGTAAACACAGATCAAGATATTGAAAAGAATCTGGATAAAATGATGAC
AGAGAGAACCCTGTTGAAGGAGCGTTACCAGGAGGTCCTGGACAAGCAGAGGCAAGTGGAGAATCAGCTCCAAGTGCAATTAAAGCAACTTCAGCAAAGG
AGAGAAGAAGAAATGAAGAATCACCAGGAGATATTAAAGGCTATCCAGGATGTAACAATAAAGCGAGAAGAAACGAAGAAGAAGATAGAGAAAGAAAAGA
AGGAGTTTTTGCAGAAGGAACAGGATCTGAAAGCTGAAATTGAGAAGCTTTGTGAGAAGGCCAGA---GAAGTGTGGGAAATGGAACTGGATAGACTCAA
GAATCAGGATGGCGAAATAAATCGGAACATTATGGAGGAGACAGAACGGGCCTGGAAGGCAGAGATTTTATCACTAGAGAGTCGGAAAGAGTTGCTGGTA
TTGAAACTAGAAGAAGCAGAAAAAGAGGCAGAACTGCACCTTACTTACCTC---TCAACTCCCCCGACACTAGAGACAGTTCGTTCCAAACAGGAATGGG
AGACAAGACTGAATGGAGTTCGAATAATGAAAAAGAATGTT---GACCAGTTTAATAGTCATATCCAGCTAGTGAGGAACGGAGCCAAGCTGAGCAGCCT
TCCTCAGATCCCTACTCCCACTTTGCCTCCACCCCCGTCAGAGACAGACTTCATGCTTCAGGTGTTTCAACCCAATCCCTCTCTGGCTCCTCGGATGCCC
TTCTCCATTGGGCAGGTCACAATGCCCATGGTTATGCCCAGTGCAGATCCCCGTTCCTTGTCTTTCCCAATCCTGAACCCTGCCCTTTCCCAGCCCAACC
AGCCTTCCCCACCCCTTCCTGGCTCCCATGGGAGAAACAGCCCCGGCTTGGGTTCCCTTGTCGGGCCCCATGGTCCACATGTGCCCCCCGCCGCCTCCAT
CCCACCTCCCCCAGGCCTGGGTGGTGTTAAGGCTTCTACTGAAACTCCCCGGCCCCAACCAGTAGACAAACTGGAGAAGATTCTGGAGAAGCTGCTGACC
CGGTTCCCACAATGCAAT---GCCCAGATGACCAACATCCTTCAGCAAATCAAGACAGCACGTACCACCATGGCAGGTCTAACCATGGAGGAACTGATCC
AGTTGGTAGCTGCACGGCTGGCAGAGCATGAGCGGGTGGCAGCAAGTACTCAGCCACTTGGTCGGATCCGGGCCTTGTTCCCTGCTCCATTGGCCCAAAT
CAGTACCCCAATGTTCTTGCCTTCTGCCCAAGTTTCATATCCTGGGAGGTCTTCACAT------------TGTAAGCTGTGTCTCATGTGCCAGAAACTT
GTCCAGCCCAGTGAGCTGCATCCAATGGCATGTACCCACGTGCTGCACAAGGAGTGTATCAAATTCTGGGCCCAGACCAACACAAATGACACTTGTCCCT
TTTGTCCAACTCTTAAATGA


>BGISUSP0000895293
MPNWSTQSRILVHRQVILLQRTEQFGENLMATALCLSGGGSQSDSKDMANTAGEEGDTCLRESPHPGTRSLKAGCHTKQPASGNCPEEKAPQASVLKEGS
RDTGLDFRPVVPPANGVEGVRVEQDDDQDSSSLKLSQNIAVQTDFKTADSEVNTDQDIEKNLDKMMTERTLLKERYQEVLDKQRQVENQLQVQLKQLQQR
REEEMKNHQEILKAIQDVTIKREETKKKIEKEKKEFLQKEQDLKAEIEKLCEKAR-EVWEMELDRLKNQDGEINRNIMEETERAWKAEILSLESRKELLV
LKLEEAEKEAELHLTYL-STPPTLETVRSKQEWETRLNGVRIMKKNV-DQFNSHIQLVRNGAKLSSLPQIPTPTLPPPPSETDFMLQVFQPNPSLAPRMP
FSIGQVTMPMVMPSADPRSLSFPILNPALSQPNQPSPPLPGSHGRNSPGLGSLVGPHGPHVPPAASIPPPPGLGGVKASTETPRPQPVDKLEKILEKLLT
RFPQCN-AQMTNILQQIKTARTTMAGLTMEELIQLVAARLAEHERVAASTQPLGRIRALFPAPLAQISTPMFLPSAQVSYPGRSSH----CKLCLMCQKL
VQPSELHPMACTHVLHKECIKFWAQTNTNDTCPFCPTLK*