Sequences
EST Library Info
cki1Kidney - RNA from China
fat3Fatt
fbs2Unavailable
lnt2Lymphatic nodule tracheobroncalis
med1Mediastinum
nmm2Newborn 115 days, mucosal membranes
pigca3Unavailable
plac1Unavailable
Clusters
Oligos
SNPs

Gene ID ENSG00000103335 (click for geneview)
Transcript ID ENST00000301015(link to ensembl)
Symbol FAM38A
Localtion Chromosome:16:87309256:87330160:-1 band: 16q24.3
Description Protein FAM38A. [Source:Uniprot/SWISSPROT;Acc:Q92508]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--D--L--R--P--E--L--P--T--T--L--G--P--V--S--L--R--Q--L--G--L--E--H--T--R--Y--P--C--L--D--L--G--A--
ATGGACCTGCGCCCTGAGCTGCCCACCACCCTGGGCCCCGTCAGCCTGCGCCAGCTGGGGCTGGAGCACACCCGCTACCCCTGTCTGGACCTTGGTGCCA
::::::::::. ::.:::::::::::::::::::::::.::::::::::: ::::::::::::::.:::::::::::::::::.:::::::: ::.::::
ATGGACCTGCAACCCGAGCTGCCCACCACCCTGGGCCCTGTCAGCCTGCGGCAGCTGGGGCTGGAACACACCCGCTACCCCTGCCTGGACCTGGGCGCCA
-M--D--L--Q--P--E--L--P--T--T--L--G--P--V--S--L--R--Q--L--G--L--E--H--T--R--Y--P--C--L--D--L--G--A--

-><-------------------------------------------------------------------------------------------------
M--L--L--Y--T--L--T--F--W--L--L-----L--R--Q--F--V--K--E--K--L--L--K--W--A--E--S--P--A--A--L--T--E--V
TGTTGCTCTACACCCTGACCTTCTGGCTCCTG---CTGCGCCAGTTTGTGAAAGAGAAGCTGCTGAAGTGGGCAGAGTCTCCAGCTGCGCTGACGGAGGT
::   :: :.::::::::::::::::::::::   :: . ::::::::::::.:::::::::::::.: ::::: . :.:   ::.::::::::::::: 
TG---CTGTGCACCCTGACCTTCTGGCTCCTGC--CTTTTCCAGTTTGTGAAGGAGAAGCTGCTGAGGAGGGCACGCTTTAATGCCGCGCTGACGGAGGG
M-----L--C--T--L--T--F--W--L--L--\--L--F--Q--F--V--K--E--K--L--L--R--R--A--R--F--N--A--A--L--T--E--G

----------------><----------------------------------------------------------------------------------
--T--V--A--D--T--E--P--T--R--T--Q--T--L--L--Q--S--L--G--E--L--V--K--G--V--Y--A--K--Y--W--I--Y--V--C-
CACCGTGGCAGACACAGAGCCCACGCGGACGCAGACGCTGTTGCAGAGCCTGGGGGAGCTGGTGAAGGGCGTGTACGCCAAGTACTGGATCTATGTGTGT
::::: :::          ::::::::::: :::::::::.:::.::::::::::::::::::  .:::: ::::.:::::::::::::::::.:::::.
CACCGNGGCT---------CCCACGCGGACTCAGACGCTGCTGCGGAGCCTGGGGGAGCTGGTCCGGGGCCTGTATGCCAAGTACTGGATCTACGTGTGC
--T--X--A-----------P--T--R--T--Q--T--L--L--R--S--L--G--E--L--V--R--G--L--Y--A--K--Y--W--I--Y--V--C-

-----------------------------------------------------------------------------------------------><---
-A--G--M--F--I--V--V--S--F--A--G--R--L--V--V--Y--K--I--V--Y--M--F--L--F--L--L--C--L--T--L--F--Q--V--
GCTGGCATGTTCATCGTGGTCAGCTTCGCCGGCCGCCTCGTGGTCTACAAGATTGTCTACATGTTCCTCTTCCTGCTCTGCCTCACCCTCTTCCAGGTCT
::.:::::::::::.::::::::::::::::::::::::::::::::::::::.:::::::::.:::::::::::::::::::::.:::::::       
GCCGGCATGTTCATTGTGGTCAGCTTCGCCGGCCGCCTCGTGGTCTACAAGATCGTCTACATGCTCCTCTTCCTGCTCTGCCTCATCCTCTTC-------
-A--G--M--F--I--V--V--S--F--A--G--R--L--V--V--Y--K--I--V--Y--M--L--L--F--L--L--C--L--I--L--F--------

----------------------------------------------------------------------------------------------------
Y--Y--S--L--W--R--K--L--L--K--A--F--W--W--L--V--V--A--Y--T--M--L--V--L--I--A--V--Y--T--F--Q--F--Q--D
ACTACAGCCTGTGGCGGAAGCTGCTCAAGGCCTTCTGGTGGCTCGTGGTGGCCTACACCATGCTGGTCCTCATCGCCGTCTACACCTTCCAGTTCCAGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------><------------------------------------------------------
--F--P--A--Y--W--R--N--L--T--G--F--T--D--E--Q--L--G--D--L--G--L--E--Q--F--S--V--S--E--L--F--S--S--I-
CTTCCCTGCCTACTGGCGCAACCTCACTGGCTTCACCGACGAGCAGCTGGGGGACCTGGGCCTGGAGCAGTTCAGCGTGTCCGAGCTCTTCTCCAGCATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-L--V--P--G--F--F--L--L--A--C--I--L--Q--L--H--Y--F--H--R--P--F--M--Q--L--T--D--M--E--H--V--S--L--P--
CTGGTGCCCGGCTTCTTCCTCCTGGCCTGCATCCTGCAGCTGCACTACTTCCACAGGCCCTTCATGCAGCTCACCGACATGGAGCACGTGTCCCTGCCTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------><-----------------------------------------------------------------------
G--T--R--L--P--R--W--A--H--R--Q--D--A--V--S--G--T--P--L--L--R--E--E--Q--Q--E--H--Q--Q--Q--Q--Q--E--E
GCACGCGCCTCCCGCGCTGGGCTCACAGGCAGGATGCAGTGAGTGGGACCCCACTGCTGCGGGAGGAGCAGCAGGAGCATCAGCAGCAGCAGCAGGAGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------><----------------------
--E--E--E--E--E--D--S--R--D--E--G--L--G--V--A--T--P--H--Q--A--T--Q--V--P--E--G--A--A--K--W--G--L--V-
GGAGGAGGAGGAGGAGGACTCCAGGGACGAGGGGCTGGGCGTGGCCACTCCCCACCAGGCCACGCAGGTGCCTGAAGGGGCAGCCAAGTGGGGCCTGGTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--E--R--L--L--E--L--A--A--G--F--S--D--V--L--S--R--V--Q--V--F--L--R--R--L--L--E--L--H--V--F--K--L--
GCTGAGCGGCTGCTGGAGCTGGCAGCCGGCTTCTCGGACGTCCTCTCACGCGTGCAGGTGTTCCTGCGGCGGCTGCTGGAGCTTCACGTTTTCAAGCTGG
                                                      ::::.:.:: ..::::: ::::::::::: :::::..:::::::::
------------------------------------------------------CAGGCGCTCGCACGGCGCCTGCTGGAGCTGCACGTCCTCAAGCTGG
-------------------------------------------------------Q--A--L--A--R--R--L--L--E--L--H--V--L--K--L--

----------------------------------><----------------------------------------------------------------
V--A--L--Y--T--V--W--V--A--L--K--E--V--S--V--M--N--L--L--L--V--V--L--W--A--F--A--L--P--Y--P--R--F--R
TGGCCCTGTACACCGTCTGGGTGGCCCTGAAGGAGGTGTCGGTGATGAACCTGCTGCTGGTGGTGCTGTGGGCCTTCGCCCTGCCCTACCCACGCTTCCG
: ::.:: ::::::::::::::::::::::::::::::::::::::::::.: ::::::::::.::: :::::::::::::::::::::::.::::::::
TCGCTCTCTACACCGTCTGGGTGGCCCTGAAGGAGGTGTCGGTGATGAACTTCCTGCTGGTGGCGCTCTGGGCCTTCGCCCTGCCCTACCCGCGCTTCCG
V--A--L--Y--T--V--W--V--A--L--K--E--V--S--V--M--N--F--L--L--V--A--L--W--A--F--A--L--P--Y--P--R--F--R

----------------------------------------------------------------------------------------------------
--P--M--A--S--C--L--S--T--V--W--T--C--V--I--I--V--C--K--M--L--Y--Q--L--K--V--V--N--P--Q--E--Y--S--S-
GCCCATGGCCTCCTGCCTGTCCACCGTGTGGACCTGCGTCATCATCGTGTGTAAGATGCTGTACCAGCTCAAGGTTGTCAACCCCCAGGAGTATTCCAGC
::::::::::::::::::: :::::::::::::::::::::::::::::::.:::::::::::::::::::::::.::::.:::::: :::::.::::::
GCCCATGGCCTCCTGCCTGGCCACCGTGTGGACCTGCGTCATCATCGTGTGCAAGATGCTGTACCAGCTCAAGGTCGTCAGCCCCCACGAGTACTCCAGC
--P--M--A--S--C--L--A--T--V--W--T--C--V--I--I--V--C--K--M--L--Y--Q--L--K--V--V--S--P--H--E--Y--S--S-

-----------><---------------------------------------------------------------------------------------
-N--C--T--E--P--F--P--N--S--T--N--L--L--P--T--E--I--S--Q--S--L--L--Y--R--G--P--V--D--P--A--N--W--F--
AACTGCACCGAGCCCTTCCCCAACAGCACCAACTTGCTGCCCACGGAGATCAGCCAGTCCCTGCTGTACCGGGGGCCCGTGGACCCTGCCAACTGGTTTG
:::::::::::::: :: :::::::.:::::::.::: :   .:::::::::::::::::.:.:::::::::::.                         
AACTGCACCGAGCCGTTGCCCAACAACACCAACCTGCAGAAGGCGGAGATCAGCCAGTCCTTACTGTACCGGGGA-------------------------
-N--C--T--E--P--L--P--N--N--T--N--L--Q--K--A--E--I--S--Q--S--L--L--Y--R--G--------------------------

-------------------------------------><-------------------------------------------------------------
G--V--R--K--G--F--P--N--L--G--Y--I--Q--N--H--L--Q--V--L--L--L--L--V--F--E--A--I--V--Y--R--R--Q--E--H
GGGTGCGGAAAGGGTTCCCCAACCTGGGCTACATCCAGAACCACCTGCAAGTGCTGCTGCTGCTGGTATTCGAGGCCATCGTGTACCGGCGCCAGGAGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--Y--R--R--Q--H--Q--L--A--P--L--P--A--Q--A--V--F--A--S--G--T--R--Q--Q--L--D--Q--D--L--L--G--C--L--K-
CTACCGCCGGCAGCACCAGCTGGCCCCGCTGCCTGCCCAGGCCGTGTTTGCCAGCGGCACCCGCCAGCAGCTGGACCAGGATCTGCTCGGCTGCCTCAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------><------------------------------------------------------------
-Y--F--I--N--F--F--F--Y--K--F--G--L--E--I--C--F--L--M--A--V--N--V--I--G--Q--R--M--N--F--L--V--T--L--
TACTTCATCAACTTCTTCTTCTACAAATTCGGGCTGGAGATCTGCTTCCTGATGGCCGTGAACGTGATCGGGCAGCGCATGAACTTTCTGGTGACCCTGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
H--G--C--W--L--V--A--I--L--T--R--R--H--R--Q--A--I--A--R--L--W--P--N--Y--C--L--F--L--A--L--F--L--L--Y
ACGGTTGCTGGCTGGTGGCCATCCTCACCCGCAGGCACCGCCAGGCCATTGCCCGCCTCTGGCCCAACTACTGCCTCTTCCTGGCGCTGTTCCTGCTGTA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------><-------------------------------------------------------
--Q--Y--L--L--C--L--G--M--P--P--A--L--C--I--D--Y--P--W--R--W--S--R--A--V--P--M--N--S--A--L--I--K--W-
CCAGTACCTGCTGTGCCTGGGGATGCCCCCGGCCCTGTGCATTGATTATCCCTGGCGCTGGAGCCGGGCCGTCCCCATGAACTCCGCACTCATCAAGTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------><--------------------------------------------------
-L--Y--L--P--D--F--F--R--A--P--N--S--T--N--L--I--S--D--F--L--L--L--L--C--A--S--Q--Q--W--Q--V--F--S--
CTGTACCTGCCTGATTTCTTCCGGGCCCCCAACTCCACCAACCTCATCAGCGACTTTCTCCTGCTGCTGTGCGCCTCCCAGCAGTGGCAGGTGTTCTCAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
A--E--R--T--E--E--W--Q--R--M--A--G--V--N--T--D--R--L--E--P--L--R--G--E--P--N--P--V--P--N--F--I--H--C
CTGAGCGCACAGAGGAGTGGCAGCGCATGGCTGGCGTCAACACCGACCGCCTGGAGCCGCTGCGGGGGGAGCCCAACCCCGTGCCCAACTTTATCCACTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--><------------------------------------------------------------------------------------------------
--R--S--Y--L--D--M--L--K--V--A--V--F--R--Y--L--F--W--L--V--L--V--V--V--F--V--T--G--A--T--R--I--S--I-
CAGGTCCTACCTTGACATGCTGAAGGTGGCCGTCTTCCGATACCTGTTCTGGCTGGTGCTGGTGGTGGTGTTTGTCACGGGGGCCACCCGCATCAGCATC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-F--G--L--G--Y--L--L--A--C--F--Y--L--L--L--F--G--T--A--L--L--Q--R--D--T--R--A--R--L--V--L--W--D--C--
TTCGGGCTGGGCTACCTGCTGGCCTGCTTCTACCTGCTGCTCTTCGGCACGGCCCTGCTGCAGAGGGACACACGGGCCCGCCTCGTGCTGTGGGACTGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------><----------------------------------------------------
L--I--L--Y--N--V--T--V--I--I--S--K--N--M--L--S--L--L--A--C--V--F--V--E--Q--M--Q--T--G--F--C--W--V--I
TCATTCTGTACAACGTCACCGTCATCATCTCCAAGAACATGCTGTCGCTCCTGGCCTGCGTCTTCGTGGAGCAGATGCAGACCGGCTTCTGCTGGGTCAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------><-------------------------------------------------------
--Q--L--F--S--L--V--C--T--V--K--G--Y--Y--D--P--K--E--M--M--D--R--D--Q--D--C--L--L--P--V--E--E--A--G-
CCAGCTCTTCAGCCTTGTATGCACCGTCAAGGGCTACTATGACCCCAAGGAGATGATGGACAGAGACCAGGACTGCCTGCTGCCTGTGGAGGAGGCTGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-I--I--W--D--S--V--C--F--F--F--L--L--L--Q--R--R--V--F--L--S--H--Y--Y--L--H--V--R--A--D--L--Q--A--T--
ATCATCTGGGACAGCGTCTGCTTCTTCTTCCTGCTGCTGCAGCGCCGCGTCTTCCTTAGCCATTACTACCTGCACGTCAGGGCCGACCTCCAGGCCACCG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------><-------------------------------------------------
A--L--L--A--S--R--Q--A--W--A--Q--T--Q--P--R--A--P--S--I--D--F--H--R--R--I--E--E--K--S--L--A--Q--L--K
CCCTGCTAGCCTCCAGGCAAGCTTGGGCCCAGACACAGCCCAGAGCTCCCAGCATTGACTTTCACCGCAGGATAGAGGAGAAGTCCCTGGCCCAGCTGAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----><---------------------------------------------------------------------------------------------
--R--Q--M--E--R--I--R--A--K--Q--E--K--H--R--Q--G--R--V--D--R--S--R--P--Q--D--T--L--G--P--K--D--P--G-
AAGACAGATGGAGCGTATCCGTGCCAAGCAGGAGAAGCACAGGCAGGGCCGGGTGGACCGCAGTCGCCCCCAGGACACCCTGGGCCCCAAGGACCCCGGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------><----------------------------------------------------------------------><-----------------
-L--E--P--G--P--D--S--P--G--G--S--S--P--P--R--R--Q--W--W--R--P--W--L--D--H--A--T--V--I--H--S--G--D--
CTGGAGCCAGGGCCCGACAGTCCAGGGGGCTCCTCCCCGCCACGGAGGCAGTGGTGGCGGCCCTGGCTGGACCACGCCACAGTCATCCACTCCGGGGACT
                                                                                    ::::::::::: ::::
------------------------------------------------------------------------------------ATCCACTCCGGCGACT
-------------------------------------------------------------------------------------I--H--S--G--D--

----------------------------------------------------------------------------------><----------------
Y--F--L--F--E--S--D--S--E--E--E--E--E--A--V--P--E--D--P--R--P--S--A--Q--S--A--F--Q--L--A--Y--Q--A--W
ACTTCCTGTTTGAGTCCGACAGTGAGGAAGAGGAGGAGGCTGTTCCTGAAGACCCGAGGCCGTCGGCACAGAGTGCCTTCCAGCTGGCGTACCAGGCATG
::: :.::::::::::.:::::::::::.:: :::::.::.   ::.::.:::::  :::: :::::::::::.:::::::::   ::.:::::.::.::
ACTACTTGTTTGAGTCTGACAGTGAGGAGGACGAGGAAGCCCAGCCCGAGGACCCCCGGCCTTCGGCACAGAGCGCCTTCCAG---GCATACCAAGCGTG
Y--Y--L--F--E--S--D--S--E--E--D--E--E--A--Q--P--E--D--P--R--P--S--A--Q--S--A--F--Q-----A--Y--Q--A--W

-------------------------------------------------------------------------------------><-------------
--V--T--N--A--Q--A--V--L--R--R--R--Q--Q--E--Q--E--Q--A--R--Q--E--Q--A--G--Q--L--P--T--G--G--G--P--S-
GGTGACCAACGCCCAGGCGGTGCTGAGGCGGCGGCAGCAGGAGCAGGAGCAGGCAAGGCAGGAACAGGCAGGACAGCTACCCACAGGAGGTGGTCCCAGC
:::::::::::: :::.::::::::::::.::.::.::::::::::                                                      
GGTGACCAACGCGCAGACGGTGCTGAGGCAGCAGCGGCAGGAGCAG------------------------------------------------------
--V--T--N--A--Q--T--V--L--R--Q--Q--R--Q--E--Q-------------------------------------------------------

------------------------------------------><--------------------------------------------------------
-Q--E--V--E--P--A--E--G--P--E--E--A--A--A--G--R--S--H--V--V--Q--R--V--L--S--T--A--Q--F--L--W--M--L--
CAGGAGGTGGAGCCAGCAGAGGGCCCCGAGGAGGCAGCGGCAGGCCGGAGCCATGTGGTGCAGAGGGTGCTGAGCACGGCGCAGTTCCTGTGGATGCTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--Q--A--L--V--D--E--L--T--R--W--L--Q--E--F--T--R--H--H--G--T--M--S--D--V--L--R--A--E--R--Y--L--L--T
GGCAGGCGCTAGTGGATGAGCTGACACGCTGGCTGCAGGAGTTCACCCGGCACCACGGCACCATGAGCGACGTGCTGCGGGCAGAGCGCTACCTCCTCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------><-----------------------------------------------------------------------------------
--Q--E--L--L--Q--G--G--E--V--H--R--G--V--L--D--Q--L--Y--T--S--Q--A--E--A--T--L--P--G--P--T--E--A--P-
ACAGGAGCTCCTGCAGGGCGGCGAAGTGCACAGGGGCGTGCTGGATCAGCTGTACACAAGCCAGGCCGAGGCCACGCTGCCAGGCCCCACCGAGGCCCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------><----------------------------------------------------------------------------
-N--A--P--S--T--V--S--S--G--L--G--A--E--E--P--L--S--S--M--T--D--D--M--G--S--P--L--S--T--G--Y--H--T--
AATGCCCCAAGCACCGTGTCCAGTGGGCTGGGCGCGGAGGAGCCACTCAGCAGCATGACAGACGACATGGGCAGCCCCCTGAGCACCGGCTACCACACGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
R--S--G--S--E--E--A--V--T--D--P--G--E--R--E--A--G--A--S--L--Y--Q--G--L--M--R--T--A--S--E--L--L--L--D
GCAGTGGCAGTGAGGAGGCAGTCACCGACCCCGGGGAGCGTGAGGCTGGTGCCTCTCTGTACCAGGGACTGATGCGGACGGCCAGCGAGCTGCTCCTGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--><------------------------------------------------------------------------------------------------
--R--R--L--R--I--P--E--L--E--E--A--E--L--F--A--E--G--Q--G--R--A--L--R--L--L--R--A--V--Y--Q--C--V--A-
CAGGCGCCTGCGCATCCCAGAGCTGGAGGAGGCAGAGCTGTTTGCGGAGGGGCAGGGCCGGGCGCTGCGGCTGCTGCGGGCCGTGTACCAGTGTGTGGCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-A--H--S--E--L--L--C--Y--F--I--I--I--L--N--H--M--V--T--A--S--A--G--S--L--V--L--P--V--L--V--F--L--W--
GCCCACTCGGAGCTGCTCTGCTACTTCATCATCATCCTCAACCACATGGTCACGGCCTCCGCCGGCTCGCTGGTGCTGCCCGTGCTCGTCTTCCTGTGGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------><-------------------------------------
A--M--L--S--I--P--R--P--S--K--R--F--W--M--T--A--I--V--F--T--E--I--A--V--V--V--K--Y--L--F--Q--F--G--F
CCATGCTGTCGATCCCGAGGCCCAGCAAGCGCTTCTGGATGACGGCCATCGTCTTCACCGAGATCGCGGTGGTCGTCAAGTACCTGTTCCAGTTTGGGTT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--F--P--W--N--S--H--V--V--L--R--R--Y--E--N--K--P--Y--F--P--P--R--I--L--G--L--E--K--T--D--G--Y--I--K-
CTTCCCCTGGAACAGCCACGTGGTGCTGCGGCGCTACGAGAACAAGCCCTACTTCCCGCCCCGCATCCTGGGCCTGGAGAAGACTGACGGCTACATCAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--------------------------------------------------><------------------------------------------------
-Y--D--L--V--Q--L--M--A--L--F--F--H--R--S--Q--L--L--C--Y--G--L--W--D--H--E--E--D--S--P--S--K--E--H--
TACGACCTGGTGCAGCTCATGGCCCTTTTCTTCCACCGCTCCCAGCTGCTGTGCTATGGCCTCTGGGACCATGAGGAGGACTCACCATCCAAGGAGCATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--K--S--G--E--E--E--Q--G--A--E--E--G--P--G--V--P--A--A--T--T--E--D--H--I--Q--V--E--A--R--V--G--P--T
ACAAGAGCGGCGAGGAGGAGCAGGGAGCCGAGGAGGGGCCAGGGGTGCCTGCGGCCACCACCGAAGACCACATTCAGGTGGAAGCCAGGGTCGGACCCAC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--D--G--T--P--E--P--Q--V--E--L--R--P--R--D--T--R--R--I--S--L--R--F--R--R--R--K--K--E--G--P--A--R--K-
GGACGGGACCCCAGAACCCCAAGTGGAGCTCAGGCCCCGTGATACGAGGCGCATCAGTCTACGTTTTAGAAGAAGGAAGAAGGAGGGCCCAGCACGGAAA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------><-----------------------------------------------------------------------------------
-G--A--A--A--I--E--A--E--D--R--E--E--E--E--G--E--E--E--K--E--A--P--T--G--R--E--K--R--P--S--R--S--G--
GGAGCGGCAGCCATCGAAGCTGAGGACAGGGAGGAAGAAGAGGGGGAGGAAGAGAAAGAGGCCCCCACGGGGAGAGAGAAGAGGCCAAGCCGCTCTGGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------><--------------------------------------------------
G--R--V--R--A--A--G--R--R--L--Q--G--F--C--L--S--L--A--Q--G--T--Y--R--P--L--R--R--F--F--H--D--I--L--H
GAAGAGTAAGGGCGGCCGGGCGGCGGCTGCAGGGCTTCTGCCTGTCCCTGGCCCAGGGCACATATCGGCCGCTACGGCGCTTCTTCCACGACATCCTGCA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------------------------------------------------------------------------------------><--
--T--K--Y--R--A--A--T--D--V--Y--A--L--M--F--L--A--D--V--V--D--F--I--I--I--I--F--G--F--W--A--F--G--K-
CACCAAGTACCGCGCAGCCACCGACGTCTATGCCCTCATGTTCCTGGCTGATGTTGTCGACTTCATCATCATCATTTTTGGCTTCTGGGCCTTTGGGAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-H--S--A--A--T--D--I--T--S--S--L--S--D--D--Q--V--P--E--A--F--L--V--M--L--L--I--Q--F--S--T--M--V--V--
CACTCGGCGGCCACAGACATCACGTCCTCCCTATCAGACGACCAGGTACCCGAGGCTTTCCTGGTCATGCTGCTGATCCAGTTCAGTACCATGGTGGTTG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
D--R--A--L--Y--L--R--K--T--V--L--G--K--L--A--F--Q--V--A--L--V--L--A--I--H--L--W--M--F--F--I--L--P--A
ACCGCGCCCTCTACCTGCGCAAGACCGTGCTGGGCAAGCTGGCCTTCCAGGTGGCGCTGGTGCTGGCCATCCACCTATGGATGTTCTTCATCCTGCCCGC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------><---------------------------------------------------------------------------------------
--V--T--E--R--M--F--N--Q--N--V--V--A--Q--L--W--Y--F--V--K--C--I--Y--F--A--L--S--A--Y--Q--I--R--C--G-
CGTCACTGAGAGGATGTTCAACCAGAATGTGGTGGCCCAGCTCTGGTACTTCGTGAAGTGCATCTACTTCGCCCTGTCCGCCTACCAGATCCGCTGCGGC
             : .::.:.::::::. ::::::::::::: ::::::::::::::::::.: :::::::  :::::::::::::::::::::::.:::
-------------AAATTTAGCCAGAACCTGGTGGCCCAGCTGTGGTACTTCGTGAAGTGCGTGTACTTCGGGCTGTCCGCCTACCAGATCCGCTGTGGC
--------------K--F--S--Q--N--L--V--A--Q--L--W--Y--F--V--K--C--V--Y--F--G--L--S--A--Y--Q--I--R--C--G-

----------------------------------------------------------------------><----------------------------
-Y--P--T--R--I--L--G--N--F--L--T--K--K--Y--N--H--L--N--L--F--L--F--Q--G--F--R--L--V--P--F--L--V--E--
TACCCCACCCGCATCCTCGGCAACTTCCTCACCAAGAAGTACAATCATCTCAACCTCTTCCTCTTCCAGGGGTTCCGGCTGGTGCCGTTCCTGGTGGAGC
:::::::: :::.::::::: ::::::::::::::::. :::::..:. :::::::::::::.::.:::                               
TACCCCACGCGCGTCCTCGGGAACTTCCTCACCAAGAGCTACAACTACGTCAACCTCTTCCTTTTTCAG-------------------------------
-Y--P--T--R--V--L--G--N--F--L--T--K--S--Y--N--Y--V--N--L--F--L--F--Q--------------------------------

----------------------------------------------------------------------------------------------------
L--R--A--V--M--D--W--V--W--T--D--T--T--L--S--L--S--S--W--M--C--V--E--D--I--Y--A--N--I--F--I--I--K--C
TGCGGGCAGTGATGGACTGGGTGTGGACGGACACCACGCTGTCCCTGTCCAGCTGGATGTGTGTGGAGGACATCTATGCCAACATCTTCATCATCAAATG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

------------------><--------------------------------------------------------------------------------
--S--R--E--T--E--K--K--Y--P--Q--P--K--G--Q--K--K--K--K--I--V--K--Y--G--M--G--G--L--I--I--L--F--L--I-
CAGCCGAGAGACAGAGAAGAAATACCCGCAGCCCAAAGGGCAGAAGAAGAAGAAGATCGTCAAGTACGGCATGGGTGGCCTCATCATCCTCTTCCTCATC
                      ::::::::::::::.::::::::::::::::::::::::::::::::::::::.::::::::: :::: .: :: .: 
----------------------TACCCGCAGCCCAAGGGGCAGAAGAAGAAGAAGATCGTCAAGTACGGCATGGGCGGCCTCATCCTCCTGCTGCTGGTG
-----------------------Y--P--Q--P--K--G--Q--K--K--K--K--I--V--K--Y--G--M--G--G--L--I--L--L--L--L--V-

----------------------------------------------------------------------------------------------------
-A--I--I--W--F--P--L--L--F--M--S--L--V--R--S--V--V--G--V--V--N--Q--P--I--D--V--T--V--T--L--K--L--G--
GCCATCATCTGGTTCCCACTGCTCTTCATGTCGCTGGTGCGCTCCGTGGTTGGGGTTGTCAACCAGCCCATCGATGTCACCGTCACCCTGAAGCTGGGCG
:::.:::::::::::::.:::::::::::::: :: ::::::::::::::.:: ::.:::::::::::::::::.:::::::::::::: ::::::::::
GCCGTCATCTGGTTCCCGCTGCTCTTCATGTCCCTCGTGCGCTCCGTGGTCGGCGTCGTCAACCAGCCCATCGACGTCACCGTCACCCTCAAGCTGGGCG
-A--V--I--W--F--P--L--L--F--M--S--L--V--R--S--V--V--G--V--V--N--Q--P--I--D--V--T--V--T--L--K--L--G--

-------><-------------------------------------------------------------------------------------------
G--Y--E--P--L--F--T--M--S--A--Q--Q--P--S--I--I--P--F--T--A--Q--A--Y--E--E--L--S--R--Q--F--D--P--Q--P
GCTATGAGCCGCTGTTCACCATGAGCGCCCAGCAGCCGTCCATCATCCCCTTCACGGCCCAGGCCTATGAGGAGCTGTCCCGGCAGTTTGACCCCCAGCC
::::.:::::::: ::::::::::::::::::::::::::::::.: :::::::::   ::::::::.:::::::::::: :::::::::::::::: ::
GCTACGAGCCGCTCTTCACCATGAGCGCCCAGCAGCCGTCCATCGTGCCCTTCACGCAGCAGGCCTACGAGGAGCTGTCCAGGCAGTTTGACCCCCACCC
G--Y--E--P--L--F--T--M--S--A--Q--Q--P--S--I--V--P--F--T--Q--Q--A--Y--E--E--L--S--R--Q--F--D--P--H--P

><--------------------------------------------------------------------------------------------------
--L--A--M--Q-----F--I--S--Q--Y--S--P--E--D--I--V--T-----A--Q--I--E--G--S--S--G--A--L--W--R--I--S--P-
GCTGGCCATGCAG---TTCATCAGCCAGTACAGCCCTGAGGACATCGTCACG---GCGCAGATTGAGGGCAGCTCCGGGGCGCTGTGGCGCATCAGTCCC
:::::::::::::   : ::::::::::::::::::.:::::::::  .      ::. :  : ..: ::::::::::::::::::::::::::::.:::
GCTGGCCATGCAGT--TGCATCAGCCAGTACAGCCCCGAGGACATCTGTCACGGCGCAGATCTGAGGTGCAGCTCCGGGGCGCTGTGGCGCATCAGCCCC
--L--A--M--Q--\--F--I--S--Q--Y--S--P--E--D--I--C--H--G--A--D--L--R--C--S--S--G--A--L--W--R--I--S--P-

-------------------------------------------------------------------------------><-------------------
-P--S--R--A--Q--M--K--R--E--L--Y--N--G--T--A--D--I--T--L--R--F--T--W--N--F--Q--R--D--L--A--K--G--G--
CCCAGCCGTGCCCAGATGAAGCGGGAGCTCTACAACGGCACGGCCGACATCACCCTGCGCTTCACCTGGAACTTCCAGAGGGACCTGGCGAAGGGAGGCA
:: ::::: :::::::::::::::::::: ::::::::::: ::::::::::::::::::::::::::::::::::::   :::::::: ::::: ::::
CCGAGCCGGGCCCAGATGAAGCGGGAGCTGTACAACGGCACCGCCGACATCACCCTGCGCTTCACCTGGAACTTCCAG---GACCTGGCCAAGGGCGGCA
-P--S--R--A--Q--M--K--R--E--L--Y--N--G--T--A--D--I--T--L--R--F--T--W--N--F--Q-----D--L--A--K--G--G--

----------------------------------------------------------------------------------------------------
T--V--E--Y--A--N--E--K--H--M--L--A--L--A--P--N--S--T--A--R--R--Q--L--A--S--L--L--E--G--T--S--D--Q--S
CTGTGGAGTATGCCAACGAGAAGCACATGCTGGCCCTGGCCCCCAACAGCACTGCACGGCGGCAGCTGGCCAGCCTGCTCGAGGGCACCTCGGACCAGTC
:.::::::::..:::::::::::::::. :::: :::::: ::::::::::::: .::::::::::::::::::::::: ::::::::::::::::::  
CCGTGGAGTACACCAACGAGAAGCACACCCTGGACCTGGCGCCCAACAGCACTGAGCGGCGGCAGCTGGCCAGCCTGCTGGAGGGCACCTCGGACCAG--
T--V--E--Y--T--N--E--K--H--T--L--D--L--A--P--N--S--T--E--R--R--Q--L--A--S--L--L--E--G--T--S--D--Q---

--><------------------------------------------------------------------------------><----------------
--V--V--I--P--N--L--F--P--K--Y--I--R--A--P--N--G--P--E--A--N--P--V--K--Q--L--Q--P--N--E--E--A--D--Y-
TGTGGTCATCCCTAATCTCTTCCCCAAGTACATCCGTGCCCCCAACGGGCCCGAAGCCAACCCTGTGAAGCAGCTGCAGCCCAATGAGGAGGCCGACTAC
    :::::.::: ..::::::::::::::::::::.:::::::::::.::.:::::::::::.::::::::.:::::.:::   :::::::::::::::
----GTCATTCCTCGCCTCTTCCCCAAGTACATCCGCGCCCCCAACGGACCTGAAGCCAACCCCGTGAAGCAACTGCAACCC---GAGGAGGCCGACTAC
-----V--I--P--R--L--F--P--K--Y--I--R--A--P--N--G--P--E--A--N--P--V--K--Q--L--Q--P-----E--E--A--D--Y-

----------------------------------------------------------------------------------------------------
-L--G--V--R--I--Q--L--R--R--E--Q-----G--A--G--A--T--G--F--L--E--W--W--V--I--E--L--Q--E--C--R--T--D--
CTCGGCGTGCGTATCCAGCTGCGGAGGGAGCAG---GGTGCGGGGGCCACCGGCTTCCTCGAATGGTGGGTCATCGAGCTGCAGGAGTGCCGGACCGACT
::::: ::::::::::::::::: :::::::.    ::. :.::::: .:.:::::::::::.::::::::::::::::::::::: ::::.:.:: .::
CTCGGGGTGCGTATCCAGCTGCGCAGGGAGCGTGTGGGCTCAGGGGCAGCTGGCTTCCTCGAGTGGTGGGTCATCGAGCTGCAGGACTGCCAGGCCCGCT
-L--G--V--R--I--Q--L--R--R--E--R--V--G--S--G--A--A--G--F--L--E--W--W--V--I--E--L--Q--D--C--Q--A--R--

------------------------------------------------------------------------><--------------------------
C--N--L--L--P--M--V--I--F--S--D--K--V--S--P--P--S--L--G--F--L--A--G--Y--G--I--M--G--L--Y--V--S--I--V
GCAACCTGCTGCCCATGGTCATTTTCAGTGACAAGGTCAGCCCACCGAGCCTCGGCTTCCTGGCTGGCTACGGCATCATGGGGCTGTACGTGTCCATCGT
::::::::::::::::::::::.:::::.::::::::::::::.:: ::::: :::::::::::.::::::   ::::::::::: ::::::::::::::
GCAACCTGCTGCCCATGGTCATCTTCAGCGACAAGGTCAGCCCGCCCAGCCTGGGCTTCCTGGCCGGCTAC---ATCATGGGGCTCTACGTGTCCATCGT
C--N--L--L--P--M--V--I--F--S--D--K--V--S--P--P--S--L--G--F--L--A--G--Y-----I--M--G--L--Y--V--S--I--V

----------------------------------------------------------------------------------------------------
--L--V--I--G--K--F--V--R--G--F--F--S--E--I--S--H--S--I--M--F--E--E--L--P--C--V--D--R--I--L--K--L--C-
GCTGGTCATCGGCAAGTTCGTGCGCGGATTCTTCAGCGAGATCTCGCACTCCATTATGTTCGAGGAGCTGCCGTGCGTGGACCGCATCCTCAAGCTCTGC
::::::::::::::::::::::::::: ::::::::::::::::::::::::::.:::::.:::::::::::::::::::::::::::::::::::::::
GCTGGTCATCGGCAAGTTCGTGCGCGGCTTCTTCAGCGAGATCTCGCACTCCATCATGTTTGAGGAGCTGCCGTGCGTGGACCGCATCCTCAAGCTCTGC
--L--V--I--G--K--F--V--R--G--F--F--S--E--I--S--H--S--I--M--F--E--E--L--P--C--V--D--R--I--L--K--L--C-

----------------------------------------------------------------------------------------------------
-Q--D--I--F--L--V--R--E--T--R--E--L--E--L--E--E--E--L--Y--A--K--L--I--F--L--Y--R--S--P--E--T--M--I--
CAGGACATCTTCCTGGTGCGGGAGACTCGGGAGCTGGAGCTGGAGGAGGAGTTGTACGCCAAGCTCATCTTCCTCTACCGCTCACCGGAGACCATGATCA
:::::::::::::::::::::::::: ::::::::::::::::::::::::.:::::::::::::::::::::: ::::::::.:: :::::::::::: 
CAGGACATCTTCCTGGTGCGGGAGACGCGGGAGCTGGAGCTGGAGGAGGAGCTGTACGCCAAGCTCATCTTCCTGTACCGCTCGCCCGAGACCATGATCC
-Q--D--I--F--L--V--R--E--T--R--E--L--E--L--E--E--E--L--Y--A--K--L--I--F--L--Y--R--S--P--E--T--M--I--

---------------------->
K--W--T--R--E--K--E--*-
AGTGGACTCGTGAGAAGGAGTAG
::::::: :: ::::::::::::
AGTGGACGCGGGAGAAGGAGTAG
Q--W--T--R--E--K--E--*-

Pig Consensus Sequence

>BGISUST0000887407
ATGGACCTGCAACCCGAGCTGCCCACCACCCTGGGCCCTGTCAGCCTGCGGCAGCTGGGGCTGGAACACACCCGCTACCCCTGCCTGGACCTGGGCGCCA
TG---CTGTGCACCCTGACCTTCTGGCTCCTgcTTTTCCAGTTTGTGAAGGAGAAGCTGCTGAGGAGGGCACGCTTTAATGCCGCGCTGACGGAGGGCAC
CGNGGCT---------CCCACGCGGACTCAGACGCTGCTGCGGAGCCTGGGGGAGCTGGTCCGGGGCCTGTATGCCAAGTACTGGATCTACGTGTGCGCC
GGCATGTTCATTGTGGTCAGCTTCGCCGGCCGCCTCGTGGTCTACAAGATCGTCTACATGCTCCTCTTCCTGCTCTGCCTCATCCTCTTC----------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------CAGGCGCTCGCACGGCGCCTGCTGGAGCTGCACGTCCTCAAGCTGGTCG
CTCTCTACACCGTCTGGGTGGCCCTGAAGGAGGTGTCGGTGATGAACTTCCTGCTGGTGGCGCTCTGGGCCTTCGCCCTGCCCTACCCGCGCTTCCGGCC
CATGGCCTCCTGCCTGGCCACCGTGTGGACCTGCGTCATCATCGTGTGCAAGATGCTGTACCAGCTCAAGGTCGTCAGCCCCCACGAGTACTCCAGCAAC
TGCACCGAGCCGTTGCCCAACAACACCAACCTGCAGAAGGCGGAGATCAGCCAGTCCTTACTGTACCGGGGA----------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------------------------------------------------------ATCCACTCCGGCGACTACT
ACTTGTTTGAGTCTGACAGTGAGGAGGACGAGGAAGCCCAGCCCGAGGACCCCCGGCCTTCGGCACAGAGCGCCTTCCAG---GCATACCAAGCGTGGGT
GACCAACGCGCAGACGGTGCTGAGGCAGCAGCGGCAGGAGCAG---------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------AAATTTAGCCAGAACCTGGTGGCCCAGCTGTGGTACTTCGTGAAGTGCGTGTACTTCGGGCTGTCCGCCTACCAGATCCGCTGTGGCTAC
CCCACGCGCGTCCTCGGGAACTTCCTCACCAAGAGCTACAACTACGTCAACCTCTTCCTTTTTCAG----------------------------------
----------------------------------------------------------------------------------------------------
-------------------TACCCGCAGCCCAAGGGGCAGAAGAAGAAGAAGATCGTCAAGTACGGCATGGGCGGCCTCATCCTCCTGCTGCTGGTGGCC
GTCATCTGGTTCCCGCTGCTCTTCATGTCCCTCGTGCGCTCCGTGGTCGGCGTCGTCAACCAGCCCATCGACGTCACCGTCACCCTCAAGCTGGGCGGCT
ACGAGCCGCTCTTCACCATGAGCGCCCAGCAGCCGTCCATCGTGCCCTTCACGCAGCAGGCCTACGAGGAGCTGTCCAGGCAGTTTGACCCCCACCCGCT
GGCCATGCAgtGCATCAGCCAGTACAGCCCCGAGGACATCTGTCACGGCGCAGATCTGAGGTGCAGCTCCGGGGCGCTGTGGCGCATCAGCCCCCCGAGC
CGGGCCCAGATGAAGCGGGAGCTGTACAACGGCACCGCCGACATCACCCTGCGCTTCACCTGGAACTTC---GACCTGGCCAAGGGCGGCACCGTGGAGT
ACACCAACGAGAAGCACACCCTGGACCTGGCGCCCAACAGCACTGAGCGGCGGCAGCTGGCCAGCCTGCTGGAGGGCACCTCGGACCAG------GTCAT
TCCTCGCCTCTTCCCCAAGTACATCCGCGCCCCCAACGGACCTGAAGCCAACCCCGTGAAGCAACTGCAACCC---GAGGAGGCCGACTACCTCGGGGTG
CGTATCCAGCTGCGCAGGGAGCGTGTGGGCTCAGGGGCAGCTGGCTTCCTCGAGTGGTGGGTCATCGAGCTGCAGGACTGCCAGGCCCGCTGCAACCTGC
TGCCCATGGTCATCTTCAGCGACAAGGTCAGCCCGCCCAGCCTGGGCTTCCTGGCCGGC---ATCATGGGGCTCTACGTGTCCATCGTGCTGGTCATCGG
CAAGTTCGTGCGCGGCTTCTTCAGCGAGATCTCGCACTCCATCATGTTTGAGGAGCTGCCGTGCGTGGACCGCATCCTCAAGCTCTGCCAGGACATCTTC
CTGGTGCGGGAGACGCGGGAGCTGGAGCTGGAGGAGGAGCTGTACGCCAAGCTCATCTTCCTGTACCGCTCGCCCGAGACCATGATCCAGTGGACGCGGG
AGAAGGAGTAG


>BGISUSP0000887407
MDLQPELPTTLGPVSLRQLGLEHTRYPCLDLGAM-LCTLTFWLLLFQFVKEKLLRRARFNAALTEGT-A---PTRTQTLLRSLGELVRGLYAKYWIYVCA
GMFIVVSFAGRLVVYKIVYMLLFLLCLILF----------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------QALARRLLELHVLKLVALYTVWVALKEVSVMNFLLVALWAFALPYPRFRPMASCLATVWTCVIIVCKMLYQLKVVSPHEYSSN
CTEPLPNNTNLQKAEISQSLLYRG----------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------IHSGDYYLFESDSEEDEEAQPEDPRPSAQSAFQ-AYQAWVTNAQTVLRQQRQEQ-------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------KFSQNLVAQLWYFVKCVYFGLSAYQIRCGY
PTRVLGNFLTKSYNYVNLFLFQ---------------------------------------------------YPQPKGQKKKKIVKYGMGGLILLLLVA
VIWFPLLFMSLVRSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPFTQQAYEELSRQFDPHPLAMQCISQYSPEDICHGADLRCSSGALWRISPPS
RAQMKRELYNGTADITLRFTWNF-DLAKGGTVEYTNEKHTLDLAPNSTERRQLASLLEGTSDQ--VIPRLFPKYIRAPNGPEANPVKQLQP-EEADYLGV
RIQLRRERVGSGAAGFLEWWVIELQDCQARCNLLPMVIFSDKVSPPSLGFLAG-IMGLYVSIVLVIGKFVRGFFSEISHSIMFEELPCVDRILKLCQDIF
LVRETRELELEEELYAKLIFLYRSPETMIQWTREKE*