Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000168038 (click for geneview)
Transcript ID ENST00000301831(link to ensembl)
Symbol Q9UF96_HUMAN
Localtion Chromosome:3:41263102:41770902:-1 band: 3p22.1
Description Hypothetical protein DKFZp434E1822 (Fragment).
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------><-------------------------------------------------------><---------
-M--P--V--V--L--H--L--V--T--S--Q--V--F--R--P--Q--V--V--T--E--E--F--L--F--S--Y--G--T--I--L--S--H--I--
ATGCCTGTAGTGCTTCACCTCGTAACTTCACAGGTATTTCGACCTCAAGTTGTGACAGAAGAGTTTCTTTTCAGCTATGGAACTATTCTTAGTCATATTA
                                 :::::::::::::: :::::::::::::::::.::::::::.:::::::::::::::::::::::::
---------------------------------GTATTTCGACCTCATGTTGTGACAGAAGAGTTCCTTTTCAGTTATGGAACTATTCTTAGTCATATTA
----------------------------------V--F--R--P--H--V--V--T--E--E--F--L--F--S--Y--G--T--I--L--S--H--I--

-----------------------------------------><---------------------------------------------------------
K--S--V--D--S--G--E--T--N--I--D--G--A--I--G--L--T--A--S--E--E--F--I--K--I--T--L--S--A--F--E--A--I--I
AATCTGTAGACTCAGGAGAAACGAACATAGATGGAGCCATAGGACTGACAGCATCAGAAGAATTTATCAAGATCACATTGTCAGCTTTTGAAGCAATAAT
:::: ::::::::::::::::: ::.:::::::::::::::   ::::..::::::::::::::::::::::::::..::::.::::::::::: .:.::
AATCAGTAGACTCAGGAGAAACTAATATAGATGGAGCCATA---CTGATGGCATCAGAAGAATTTATCAAGATCACGCTGTCGGCTTTTGAAGCTGTGAT
K--S--V--D--S--G--E--T--N--I--D--G--A--I-----L--M--A--S--E--E--F--I--K--I--T--L--S--A--F--E--A--V--I

------------------------------------><--------------------------------------------------><----------
--Q--Y--P--I--L--L--K--D--Y--R--S--T--V--V--D--Y--I--L--P--P--L--V--S--L--V--Q--S--Q--N--V--E--W--R-
ACAGTATCCTATTTTATTGAAAGACTATCGCTCCACGGTTGTTGACTATATACTGCCACCCTTGGTGTCCTTGGTTCAAAGCCAAAATGTGGAGTGGAGA
::::::::::::::::::::::::::::.::::.:::                                                      :::::::::
ACAGTATCCTATTTTATTGAAAGACTATTGCTCTACG------------------------------------------------------GAGTGGAGA
--Q--Y--P--I--L--L--K--D--Y--C--S--T--------------------------------------------------------E--W--R-

----------------------------------------------------------------------------------------------------
-L--F--S--L--R--L--L--S--E--T--T--S--L--L--V--N--Q--E--F--G--D--G--K--E--K--A--S--V--D--S--D--S--N--
CTCTTTAGCTTGCGGTTGCTCTCAGAAACCACATCTCTACTCGTGAACCAGGAGTTTGGGGATGGCAAGGAGAAGGCCAGTGTTGATTCTGACAGCAATC
:::::.::::::::.::::::::::::::::::::::: ::.:::::::::::: :::. :::::::::.::.:::: :..::::::::.:::::::.::
CTCTTCAGCTTGCGATTGCTCTCAGAAACCACATCTCTTCTTGTGAACCAGGAGGTTGACGATGGCAAGAAGGAGGCGAACGTTGATTCCGACAGCAGTC
-L--F--S--L--R--L--L--S--E--T--T--S--L--L--V--N--Q--E--V--D--D--G--K--K--E--A--N--V--D--S--D--S--S--

---------------------------------><-----------------------------------------------------------------
L--L--A--L--I--R--D--V--L--L--P--Q--Y--E--H--I--L--L--E--P--D--P--V--P--A--Y--A--L--K--L--L--V--A--M
TTCTGGCTCTCATTCGAGATGTCTTACTTCCCCAGTATGAGCACATTCTTTTAGAACCTGACCCAGTACCAGCATATGCTCTGAAACTGCTAGTCGCGAT
:::::: .:::::: ::::  .::::::::::   ::.::::::::.::. :.::.:::::::: :: :::::::::::::::::.::::: ::::: ::
TTCTGGGCCTCATTAGAGAGTCCTTACTTCCC---TACGAGCACATCCTCATGGAGCCTGACCCCGTCCCAGCATATGCTCTGAAGCTGCTTGTCGCTAT
L--L--G--L--I--R--E--S--L--L--P-----Y--E--H--I--L--M--E--P--D--P--V--P--A--Y--A--L--K--L--L--V--A--M

--------------------------><-----------------------------------------------><-----------------------
--T--E--H--N--P--T--F--T--R--L--V--E--E--S--K--L--I--P--L--I--F--E--V--T--L--E--H--Q--E--S--I--L--G-
GACTGAACACAACCCAACTTTCACAAGACTTGTGGAAGAAAGCAAACTGATCCCACTCATTTTTGAAGTAACTCTGGAACATCAGGAGAGCATTCTGGGT
::: :::::::.:::::::::.      ::::::::::::::::::.::::::::: ::::::.:::::::.:::::: :::::: :::.::::::::::
GACGGAACACAGCCCAACTTTT------CTTGTGGAAGAAAGCAAATTGATCCCACGCATTTTCGAAGTAATTCTGGACCATCAGCAGAACATTCTGGGT
--T--E--H--S--P--T--F--------L--V--E--E--S--K--L--I--P--R--I--F--E--V--I--L--D--H--Q--Q--N--I--L--G-

---------------------------------------------------------------------------------><-----------------
-N--T--M--Q--S--V--I--A--L--L--S--N--L--V--A--C--K--D--S--N--M--E--L--L--Y--E--Q--G--L--V--S--H--I--
AATACCATGCAAAGTGTGATTGCATTACTCAGCAATCTAGTTGCCTGCAAAGATTCGAATATGGAACTACTTTATGAACAAGGACTTGTCAGTCACATCT
::.::::::::::::::::::::.::.::::.::::::.::..::::::::::::::::::::.:.:::::::::::.:::   :: ::: .:::..:::
AACACCATGCAAAGTGTGATTGCGTTGCTCAACAATCTGGTCACCTGCAAAGATTCGAATATGAAGCTACTTTATGAGCAA---CTAGTCCATCATGTCT
-N--T--M--Q--S--V--I--A--L--L--N--N--L--V--T--C--K--D--S--N--M--K--L--L--Y--E--Q-----L--V--H--H--V--

----------------------------------------------------------------------------------------------------
C--N--L--L--T--E--T--A--T--L--C--L--D--V--D--N--K--N--N--N--E--M--A--A--P--L--L--F--S--L--L--D--I--L
GTAACCTGCTCACTGAAACTGCCACACTGTGCTTGGATGTGGACAATAAAAACAACAATGAGATGGCAGCTCCACTGCTCTTTTCCCTGCTTGATATTTT
:::::::..:::::::::::::::::::::::::::::::::::::::::::::::.:.::::.::::::. : ::::::::::::::.::::: :::::
GTAACCTATTCACTGAAACTGCCACACTGTGCTTGGATGTGGACAATAAAAACAACGACGAGACGGCAGCCGCCCTGCTCTTTTCCCTACTTGAAATTTT
C--N--L--F--T--E--T--A--T--L--C--L--D--V--D--N--K--N--N--D--E--T--A--A--A--L--L--F--S--L--L--E--I--L

------------------------------------------------><--------------------------------------------------
--H--S--M--L--T--Y--T--S--G--I--V--R--L--A--L--Q--A--Q--K--S--G--S--G--E--D--P--Q--A--A--E--D--L--L-
GCACAGCATGCTGACCTATACCTCCGGTATTGTACGGCTGGCTTTGCAGGCCCAGAAGTCTGGCTCAGGAGAGGACCCTCAGGCTGCAGAAGACCTGCTG
::::::::::::::: ::::: ::.:: .:.::. :::::::..::::::: :::::::: ::::::::::.:..: ::::::::::::::::.::::: 
GCACAGCATGCTGACGTATACATCTGGGGTCGTGAGGCTGGCCCTGCAGGCACAGAAGTCAGGCTCAGGAGGGAGCACTCAGGCTGCAGAAGATCTGCTC
--H--S--M--L--T--Y--T--S--G--V--V--R--L--A--L--Q--A--Q--K--S--G--S--G--G--S--T--Q--A--A--E--D--L--L-

-----------------------------------------------><---------------------------------------------------
-L--L--N--R--P--L--T--D--L--I--S--L--L--I--P--L--L--P--N--E--D--P--E--I--F--D--V--S--S--K--C--L--S--
CTGCTCAACAGACCTCTGACAGACCTGATTAGCCTGCTCATTCCACTGCTTCCTAATGAAGATCCTGAGATTTTTGATGTTTCATCCAAGTGCCTGTCTA
:::::::.::..::.::::::::.:: .:.::::::::.::.::.::::::::::.:::.::::::::.::::::::..:.:::::::::::.:::::::
CTGCTCAGCAAGCCCCTGACAGATCTCGTCAGCCTGCTTATCCCGCTGCTTCCTAGTGAGGATCCTGAAATTTTTGACATCTCATCCAAGTGTCTGTCTA
-L--L--S--K--P--L--T--D--L--V--S--L--L--I--P--L--L--P--S--E--D--P--E--I--F--D--I--S--S--K--C--L--S--

----------------------------------------------------------------------------------------------------
I--L--V--Q--L--Y--G--G--E--N--P--D--S--L--S--P--E--N--V--E--I--F--A--H--L--L--T--S--K--E--D--P--K--E
TACTGGTTCAGCTGTATGGAGGGGAAAACCCGGACAGCCTCTCTCCTGAAAATGTGGAAATTTTTGCTCATTTACTGACATCCAAGGAGGACCCAAAGGA
::::::::::::::::.::::::::::::::.:::::::: :::::::::::::..::.: .:::::: ::::::::::::::::.::::::::::::::
TACTGGTTCAGCTGTACGGAGGGGAAAACCCAGACAGCCTGTCTCCTGAAAATGCAGAGAACTTTGCTGATTTACTGACATCCAAAGAGGACCCAAAGGA
I--L--V--Q--L--Y--G--G--E--N--P--D--S--L--S--P--E--N--A--E--N--F--A--D--L--L--T--S--K--E--D--P--K--E

---------------------------------><-----------------------------------------------------------------
--Q--K--L--L--L--R--I--L--R--R--M--I--T--S--N--E--K--H--L--E--S--L--K--N--A--G--S--L--L--R--A--L--E-
GCAGAAGCTTCTGTTAAGGATTCTCAGAAGAATGATCACCTCCAATGAGAAGCACTTGGAGAGCCTCAAGAATGCAGGCAGCCTCCTGCGGGCTCTGGAG
:::::::::::::.:.:::::.:::::.::::::::::::::::.::::::::::.: ::.::::::::: :::::::::::::::::::::::::::::
GCAGAAGCTTCTGCTGAGGATCCTCAGGAGAATGATCACCTCCAGTGAGAAGCACCTCGAAAGCCTCAAGCATGCAGGCAGCCTCCTGCGGGCTCTGGAG
--Q--K--L--L--L--R--I--L--R--R--M--I--T--S--S--E--K--H--L--E--S--L--K--H--A--G--S--L--L--R--A--L--E-

-------------------><-------------------------------------------------------------->
-R--L--A--P--G--S--G--S--F--A--D--S--A--V--A--P--L--A--L--E--I--L--Q--A--V--G--H--*-
CGGCTGGCCCCTGGGAGTGGTTCATTTGCCGACAGTGCGGTGGCTCCCTTGGCCCTGGAAATCCTCCAAGCCGTTGGGCACTAG
.::::::::                                                                           
TGGCTGGCC---------------------------------------------------------------------------
-W--L--A----------------------------------------------------------------------------

Pig Consensus Sequence

>BGISUST0000886947
---------------------------------GTATTTCGACCTCATGTTGTGACAGAAGAGTTCCTTTTCAGTTATGGAACTATTCTTAGTCATATTA
AATCAGTAGACTCAGGAGAAACTAATATAGATGGAGCCATA---CTGATGGCATCAGAAGAATTTATCAAGATCACGCTGTCGGCTTTTGAAGCTGTGAT
ACAGTATCCTATTTTATTGAAAGACTATTGCTCTACG------------------------------------------------------GAGTGGAGA
CTCTTCAGCTTGCGATTGCTCTCAGAAACCACATCTCTTCTTGTGAACCAGGAGGTTGACGATGGCAAGAAGGAGGCGAACGTTGATTCCGACAGCAGTC
TTCTGGGCCTCATTAGAGAGTCCTTACTTCCC---TACGAGCACATCCTCATGGAGCCTGACCCCGTCCCAGCATATGCTCTGAAGCTGCTTGTCGCTAT
GACGGAACACAGCCCAACTTTT------CTTGTGGAAGAAAGCAAATTGATCCCACGCATTTTCGAAGTAATTCTGGACCATCAGCAGAACATTCTGGGT
AACACCATGCAAAGTGTGATTGCGTTGCTCAACAATCTGGTCACCTGCAAAGATTCGAATATGAAGCTACTTTATGAGCAA---CTAGTCCATCATGTCT
GTAACCTATTCACTGAAACTGCCACACTGTGCTTGGATGTGGACAATAAAAACAACGACGAGACGGCAGCCGCCCTGCTCTTTTCCCTACTTGAAATTTT
GCACAGCATGCTGACGTATACATCTGGGGTCGTGAGGCTGGCCCTGCAGGCACAGAAGTCAGGCTCAGGAGGGAGCACTCAGGCTGCAGAAGATCTGCTC
CTGCTCAGCAAGCCCCTGACAGATCTCGTCAGCCTGCTTATCCCGCTGCTTCCTAGTGAGGATCCTGAAATTTTTGACATCTCATCCAAGTGTCTGTCTA
TACTGGTTCAGCTGTACGGAGGGGAAAACCCAGACAGCCTGTCTCCTGAAAATGCAGAGAACTTTGCTGATTTACTGACATCCAAAGAGGACCCAAAGGA
GCAGAAGCTTCTGCTGAGGATCCTCAGGAGAATGATCACCTCCAGTGAGAAGCACCTCGAAAGCCTCAAGCATGCAGGCAGCCTCCTGCGGGCTCTGGAG
TGGCTGGCC---------------------------------------------------------------------------


>BGISUSP0000886947
-----------VFRPHVVTEEFLFSYGTILSHIKSVDSGETNIDGAI-LMASEEFIKITLSAFEAVIQYPILLKDYCST------------------EWR
LFSLRLLSETTSLLVNQEVDDGKKEANVDSDSSLLGLIRESLLP-YEHILMEPDPVPAYALKLLVAMTEHSPTF--LVEESKLIPRIFEVILDHQQNILG
NTMQSVIALLNNLVTCKDSNMKLLYEQ-LVHHVCNLFTETATLCLDVDNKNNDETAAALLFSLLEILHSMLTYTSGVVRLALQAQKSGSGGSTQAAEDLL
LLSKPLTDLVSLLIPLLPSEDPEIFDISSKCLSILVQLYGGENPDSLSPENAENFADLLTSKEDPKEQKLLLRILRRMITSSEKHLESLKHAGSLLRALE
WLA-------------------------