Sequences
EST Library Info
cov1Ovary - RNA from China
Clusters
Oligos
SNPs

Gene ID ENSG00000168077 (click for geneview)
Transcript ID ENST00000301904(link to ensembl)
Symbol SCARA3
Localtion Chromosome:8:27547496:27586456:1 band: 8p21.1
Description scavenger receptor class A, member 3 isoform 2 [Source:RefSeq_peptide;Acc:NP_878185]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-----><--------------------------------------------------------------------------------------------
-M--K--V--R--S--A--G--G--D--G--D--A--L--C--V--T--E--E--D--L--A--G--D--D--E--D--M--P--T--F--P--C--T--
ATGAAAGTGAGGTCGGCCGGCGGCGATGGAGATGCCTTGTGCGTTACAGAAGAGGACCTGGCGGGTGACGACGAGGACATGCCGACCTTCCCATGCACCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----><---------------------------------------------------------------------------------------------
Q--K--G--R--P--G--P--R--C--S--R--C--Q--K--N--L--S--L--H--T--S--V--R--I--L--Y--L--F--L--A--L--L--L--V
AGAAGGGCCGGCCAGGGCCCCGCTGCAGCCGCTGCCAGAAGAACCTATCTTTGCACACATCGGTGCGGATTCTTTACCTCTTCCTGGCCCTGCTCCTGGT
        :::::.:::::::::::::::::::::::::.::::::.:::::::::::.:: ::::::::::::::::::::::::::::::::::::::
--------CGGCCGGGGCCCCGCTGCAGCCGCTGCCAGAGGAACCTGTCTTTGCACACGTCTGTGCGGATTCTTTACCTCTTCCTGGCCCTGCTCCTGGT
---------R--P--G--P--R--C--S--R--C--Q--R--N--L--S--L--H--T--S--V--R--I--L--Y--L--F--L--A--L--L--L--V

-------------------------><-------------------------------------------------------------------------
--A--V--A--V--L--A--S--L--V--F--R--K--V--D--S--L--S--E--D--I--S--L--T--Q--S--I--Y--D--K--K--L--V--L-
GGCCGTGGCTGTGTTGGCCTCTCTGGTTTTCAGAAAAGTGGACTCTCTCTCCGAAGACATCTCCTTGACCCAGTCTATTTATGACAAGAAGCTTGTGTTA
:::::::::.:::.:::::::::::   :::::.:::::::::::.::::: :::::::::::::::.::::: :.::::::::::::::::::::::. 
GGCCGTGGCCGTGCTGGCCTCTCTG---TTCAGGAAAGTGGACTCCCTCTCAGAAGACATCTCCTTGGCCCAGGCCATTTATGACAAGAAGCTTGTGTCT
--A--V--A--V--L--A--S--L-----F--R--K--V--D--S--L--S--E--D--I--S--L--A--Q--A--I--Y--D--K--K--L--V--S-

------------------------><--------------------------------------------------------------------------
-M--Q--K--N--L--Q--G--L--D--P--K--A--L--N--N--C--S--F--C--H--E--A--G--Q--L--G--P--E--I--R--K--L--Q--
ATGCAGAAAAATCTCCAGGGCCTGGATCCGAAAGCCCTGAACAACTGCTCTTTCTGCCATGAAGCTGGGCAGCTGGGGCCAGAGATCCGAAAACTGCAGG
::::::.::::::::::.:: :::   :.::::::.:..::::::::::::::::::.::::.:::::::::.:::::: ::::::: ::::::::::::
ATGCAGGAAAATCTCCAAGGGCTG---CTGAAAGCTCCAAACAACTGCTCTTTCTGCTATGAGGCTGGGCAGTTGGGGCAAGAGATCAGAAAACTGCAGG
-M--Q--E--N--L--Q--G--L-----L--K--A--P--N--N--C--S--F--C--Y--E--A--G--Q--L--G--Q--E--I--R--K--L--Q--

----------------------------------------------------------------------------------------------------
E--E--L--E--G--I--Q--K--L--L--L--A--Q--E--V--Q--L--D--Q--T--L--Q--A--Q--E--V--L--S--T--T--S--R--Q--I
AGGAGCTGGAGGGAATTCAGAAGCTGCTTCTGGCCCAGGAGGTGCAGCTGGACCAGACCTTACAGGCCCAGGAGGTGCTCTCCACCACCAGCAGACAAAT
::::::::::::::::::::::: ::::::::::.::.::::: ::::::::::::.:::. :::.:::::::: :::::::::::::::::.::::.::
AGGAGCTGGAGGGAATTCAGAAGATGCTTCTGGCTCAAGAGGTCCAGCTGGACCAGGCCTCCCAGACCCAGGAGCTGCTCTCCACCACCAGCGGACAGAT
E--E--L--E--G--I--Q--K--M--L--L--A--Q--E--V--Q--L--D--Q--A--S--Q--T--Q--E--L--L--S--T--T--S--G--Q--I

----------------------------------------------------------------------------------------------------
--S--Q--E--M--G--S--C--S--F--S--I--H--Q--V--N--Q--S--L--G--L--F--L--A--Q--V--R--G--W--Q--A--T--T--A-
CTCCCAGGAGATGGGCAGTTGCTCCTTCTCCATCCACCAGGTTAACCAGTCTCTGGGGCTCTTCCTGGCCCAGGTGAGAGGCTGGCAGGCCACCACAGCT
:::::::::::::::::::::.::.:::::::::::::::::.::::::::::::::::::::::::::::::::::.:::.::::::.::::::::::.
CTCCCAGGAGATGGGCAGTTGTTCTTTCTCCATCCACCAGGTCAACCAGTCTCTGGGGCTCTTCCTGGCCCAGGTGAAAGGTTGGCAGACCACCACAGCC
--S--Q--E--M--G--S--C--S--F--S--I--H--Q--V--N--Q--S--L--G--L--F--L--A--Q--V--K--G--W--Q--T--T--T--A-

----------------------------------------------------------------------------------------------------
-G--L--D--L--S--L--K--D--L--T--Q--E--C--Y--D--V--K--A--A--V--H--Q--I--N--F--T--V--G--Q--T--S--E--W--
GGCCTGGACCTCTCTCTGAAGGACCTCACCCAGGAGTGCTACGATGTCAAGGCTGCAGTGCACCAGATCAACTTCACCGTGGGGCAGACTTCCGAGTGGA
.::::::::::::::::::::::::::::::::::::::::::::::::::::::::.:::::::::::::.::::::::::::::::::::.:::::::
AGCCTGGACCTCTCTCTGAAGGACCTCACCCAGGAGTGCTACGATGTCAAGGCTGCAATGCACCAGATCAATTTCACCGTGGGGCAGACTTCTGAGTGGA
-S--L--D--L--S--L--K--D--L--T--Q--E--C--Y--D--V--K--A--A--M--H--Q--I--N--F--T--V--G--Q--T--S--E--W--

----------------------------------------------------------------------------------------------------
I--H--G--I--Q--R--K--T--D--E--E--T--L--T--L--Q--K--I--V--T--D--W--Q--N--Y--T--R--L--F--S--G--L--R--T
TCCACGGGATCCAGCGGAAGACAGACGAGGAGACCCTGACCCTCCAGAAGATTGTCACCGACTGGCAGAACTACACACGGCTCTTCAGCGGCCTGCGCAC
::::.:::::::.:::::::::.::::::::::::::::::::.:::::::: :::::::::::::::::::::::.::::::::::::.::::::::::
TCCATGGGATCCGGCGGAAGACGGACGAGGAGACCCTGACCCTTCAGAAGATGGTCACCGACTGGCAGAACTACACGCGGCTCTTCAGCAGCCTGCGCAC
I--H--G--I--R--R--K--T--D--E--E--T--L--T--L--Q--K--M--V--T--D--W--Q--N--Y--T--R--L--F--S--S--L--R--T

----------------------------------------------------------------------------------------------------
--T--S--T--K--T--G--E--A--V--K--N--I--Q--A--T--L--G--A--S--S--Q--R--I--S--Q--N--S--E--S--M--H--D--L-
CACCTCCACCAAGACTGGAGAGGCGGTCAAGAACATCCAGGCCACCCTGGGGGCCTCCTCACAGCGCATCAGCCAGAACTCAGAGAGCATGCACGACCTG
:::::: .::::::: :::::.:: ::::::::::::::::: ::::::::::. :: :: :::::::::::::::::. : ::::::::::::::::::
CACCTCAGCCAAGACGGGAGAAGCCGTCAAGAACATCCAGGCAACCCTGGGGGTGTCGTCCCAGCGCATCAGCCAGAATGCCGAGAGCATGCACGACCTG
--T--S--A--K--T--G--E--A--V--K--N--I--Q--A--T--L--G--V--S--S--Q--R--I--S--Q--N--A--E--S--M--H--D--L-

----------------------------------------------------------------------------------------------------
-V--L--Q--V--M--G--L--Q--L--Q--L--D--N--I--S--S--F--L--D--D--H--E--E--N--M--H--D--L--Q--Y--H--T--H--
GTACTCCAGGTCATGGGCTTGCAGCTGCAGCTGGATAACATCTCGTCCTTCCTGGATGACCACGAAGAGAACATGCATGATCTTCAGTACCATACCCACT
::.:: ::::::::::::::::::::.::::::::::::::::: ::::::::::::::.:::::.:::::::::::.::..: ::::::::.::::.::
GTGCTGCAGGTCATGGGCTTGCAGCTACAGCTGGATAACATCTCCTCCTTCCTGGATGATCACGAGGAGAACATGCACGACTTGCAGTACCACACCCGCT
-V--L--Q--V--M--G--L--Q--L--Q--L--D--N--I--S--S--F--L--D--D--H--E--E--N--M--H--D--L--Q--Y--H--T--R--

----------------------------------------------------------------------------------------------------
Y--A--Q--N--R--T--V--E--R--F--E--S--L--E--G--R--M--A--S--H--E--I--E--I--G--T--I--F--T--N--I--N--A--T
ACGCCCAGAACCGCACTGTGGAGAGGTTTGAGTCTCTGGAAGGACGCATGGCTTCTCACGAGATTGAAATTGGCACCATCTTCACCAACATCAATGCCAC
:.:::::::::::::: ::::::::.:::::: : :: ::::: :::::::::::.::::::::.::.::.::.::::::::::::::::::::::::::
ATGCCCAGAACCGCACGGTGGAGAGATTTGAGACGCTCGAAGGCCGCATGGCTTCCCACGAGATCGAGATCGGTACCATCTTCACCAACATCAATGCCAC
Y--A--Q--N--R--T--V--E--R--F--E--T--L--E--G--R--M--A--S--H--E--I--E--I--G--T--I--F--T--N--I--N--A--T

----------------------------------------------------------------------------------------------------
--D--N--H--V--H--S--M--L--K--Y--L--D--D--V--R--L--S--C--T--L--G--F--H--T--H--A--E--E--L--Y--Y--L--N-
CGACAACCACGTGCACAGCATGCTCAAGTACCTGGATGACGTGCGGCTCTCCTGCACGCTGGGCTTCCACACCCATGCCGAGGAGCTCTACTACCTGAAC
 ::::.:::::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::
GGACAGCCACGTGTACAGCATGCTCAAGTACCTGGATGACGTGCGGCTCTCCTGCACGCTGGGCTTCCACACCCACGCCGAGGAGCTCTACTACCTGAAC
--D--S--H--V--Y--S--M--L--K--Y--L--D--D--V--R--L--S--C--T--L--G--F--H--T--H--A--E--E--L--Y--Y--L--N-

----------------------------------------------------------------------------------------------------
-K--S--V--S--I--M--L--G--T--T--D--L--L--R--E--R--F--S--L--L--S--A--R--L--D--L--N--V--R--N--L--S--M--
AAGTCTGTCTCCATCATGCTGGGCACCACAGACCTGCTCCGGGAGCGCTTCAGCCTGCTCAGTGCCCGGCTGGACCTCAACGTCCGGAACCTCTCCATGA
:::::.:::::: ::::::::                                                                               
AAGTCCGTCTCCCTCATGCTG-------------------------------------------------------------------------------
-K--S--V--S--L--M--L--------------------------------------------------------------------------------

--------------------------------------------------------------------><------------------------------
I--V--E--E--M--K--A--V--D--T--Q--H--G--E--I--L--R--N--V--T--I--L--R--G--A--P--G--P--P--G--P--R--G--F
TCGTGGAGGAGATGAAGGCAGTGGACACACAGCATGGAGAAATCCTTCGCAATGTCACCATCCTACGAGGTGCCCCCGGCCCTCCAGGACCAAGAGGATT
                                                                       :::::::::::::::::::::::::::.:
-----------------------------------------------------------------------GCCCCCGGCCCTCCAGGACCAAGAGGACT
------------------------------------------------------------------------A--P--G--P--P--G--P--R--G--L

----------------------------------------------------------------------------------------------------
--K--G--D--M--G--V--K--G--P--V--G--G--R--G--P--K--G--D--P--G--S--L--G--P--L--G--P--Q--G--P--Q--G--Q-
CAAAGGAGATATGGGCGTGAAAGGGCCTGTTGGCGGCAGAGGCCCGAAAGGAGACCCCGGCAGCTTGGGCCCCCTGGGACCCCAGGGTCCTCAGGGGCAA
:::.:::::..::::::::::::::::...::::.::::::: ::.::::::::::: :::::::::::.::::..::.:::::::: :::::::::::.
CAAGGGAGACGTGGGCGTGAAAGGGCCCACTGGCAGCAGAGGACCAAAAGGAGACCCGGGCAGCTTGGGTCCCCCAGGGCCCCAGGGGCCTCAGGGGCAG
--K--G--D--V--G--V--K--G--P--T--G--S--R--G--P--K--G--D--P--G--S--L--G--P--P--G--P--Q--G--P--Q--G--Q-

----------------------------------------------------------------------------------------------------
-P--G--E--A--G--P--V--G--E--R--G--P--V--G--P--R--G--F--P--G--L--K--G--S--K--G--S--F--G--T--G--G--P--
CCTGGAGAGGCCGGGCCTGTGGGAGAAAGGGGCCCTGTTGGCCCTCGAGGGTTCCCAGGCCTCAAAGGCTCAAAGGGCAGCTTTGGAACTGGAGGGCCGA
::.::.:: .::::.:: :::::::::::::: :: :: ::::. ::::: :::::::: :::::::::::.:::::::::::.::::::::::: :: :
CCCGGGGATACCGGACCGGTGGGAGAAAGGGGGCCAGTGGGCCTGCGAGGTTTCCCAGGACTCAAAGGCTCGAAGGGCAGCTTCGGAACTGGAGGCCCCA
-P--G--D--T--G--P--V--G--E--R--G--P--V--G--L--R--G--F--P--G--L--K--G--S--K--G--S--F--G--T--G--G--P--

----------------------------------------------------------------------------------------------------
R--G--Q--P--G--P--K--G--D--I--G--P--P--G--P--E--G--P--P--G--S--P--G--P--S--G--P--Q--G--K--P--G--I--A
GAGGACAGCCAGGCCCAAAAGGGGACATAGGGCCCCCAGGGCCAGAAGGGCCCCCGGGGTCTCCAGGGCCCTCAGGGCCTCAGGGAAAACCGGGAATTGC
:::::::::::::::: ::::::::..:.:::::::::::::: ::.::::::::.::::: :: :::::   .::::::::.::::::::.:: ::.::
GAGGACAGCCAGGCCCCAAAGGGGATGTGGGGCCCCCAGGGCCTGAGGGGCCCCCAGGGTCGCCTGGGCCAGAGGGGCCTCAAGGAAAACCAGGCATCGC
R--G--Q--P--G--P--K--G--D--V--G--P--P--G--P--E--G--P--P--G--S--P--G--P--E--G--P--Q--G--K--P--G--I--A

----------------------------------------------------------------------------------------------------
--G--K--T--G--S--P--G--Q--R--G--A--M--G--P--K--G--E--P--G--I--Q--G--P--P--G--L--P--G--P--P--G--P--P-
AGGGAAGACAGGGTCACCAGGCCAGCGGGGGGCCATGGGGCCTAAGGGTGAACCAGGGATCCAGGGTCCCCCTGGTCTCCCGGGGCCTCCAGGTCCACCA
 :::::::::::::::::::::::::::::. :..:.::::::::::::::::::::::::::::::::::::::.::::: :: ::.::::::::::::
CGGGAAGACAGGGTCACCAGGCCAGCGGGGACCTGTAGGGCCTAAGGGTGAACCAGGGATCCAGGGTCCCCCTGGCCTCCCTGGTCCCCCAGGTCCACCA
--G--K--T--G--S--P--G--Q--R--G--P--V--G--P--K--G--E--P--G--I--Q--G--P--P--G--L--P--G--P--P--G--P--P-

-------------------->
-G--S--Q--S--F--Y--*-
GGAAGCCAGAGCTTCTACTGA
::::::::::::. :::::::
GGAAGCCAGAGCCACTACTGA
-G--S--Q--S--H--Y--*-

Pig Consensus Sequence

>BGISUST0000890367
----------------------------------------------------------------------------------------------------
--------CGGCCGGGGCCCCGCTGCAGCCGCTGCCAGAGGAACCTGTCTTTGCACACGTCTGTGCGGATTCTTTACCTCTTCCTGGCCCTGCTCCTGGT
GGCCGTGGCCGTGCTGGCCTCTCTG---TTCAGGAAAGTGGACTCCCTCTCAGAAGACATCTCCTTGGCCCAGGCCATTTATGACAAGAAGCTTGTGTCT
ATGCAGGAAAATCTCCAAGGGCTG---CTGAAAGCTCCAAACAACTGCTCTTTCTGCTATGAGGCTGGGCAGTTGGGGCAAGAGATCAGAAAACTGCAGG
AGGAGCTGGAGGGAATTCAGAAGATGCTTCTGGCTCAAGAGGTCCAGCTGGACCAGGCCTCCCAGACCCAGGAGCTGCTCTCCACCACCAGCGGACAGAT
CTCCCAGGAGATGGGCAGTTGTTCTTTCTCCATCCACCAGGTCAACCAGTCTCTGGGGCTCTTCCTGGCCCAGGTGAAAGGTTGGCAGACCACCACAGCC
AGCCTGGACCTCTCTCTGAAGGACCTCACCCAGGAGTGCTACGATGTCAAGGCTGCAATGCACCAGATCAATTTCACCGTGGGGCAGACTTCTGAGTGGA
TCCATGGGATCCGGCGGAAGACGGACGAGGAGACCCTGACCCTTCAGAAGATGGTCACCGACTGGCAGAACTACACGCGGCTCTTCAGCAGCCTGCGCAC
CACCTCAGCCAAGACGGGAGAAGCCGTCAAGAACATCCAGGCAACCCTGGGGGTGTCGTCCCAGCGCATCAGCCAGAATGCCGAGAGCATGCACGACCTG
GTGCTGCAGGTCATGGGCTTGCAGCTACAGCTGGATAACATCTCCTCCTTCCTGGATGATCACGAGGAGAACATGCACGACTTGCAGTACCACACCCGCT
ATGCCCAGAACCGCACGGTGGAGAGATTTGAGACGCTCGAAGGCCGCATGGCTTCCCACGAGATCGAGATCGGTACCATCTTCACCAACATCAATGCCAC
GGACAGCCACGTGTACAGCATGCTCAAGTACCTGGATGACGTGCGGCTCTCCTGCACGCTGGGCTTCCACACCCACGCCGAGGAGCTCTACTACCTGAAC
AAGTCCGTCTCCCTCATGCTG-------------------------------------------------------------------------------
-----------------------------------------------------------------------GCCCCCGGCCCTCCAGGACCAAGAGGACT
CAAGGGAGACGTGGGCGTGAAAGGGCCCACTGGCAGCAGAGGACCAAAAGGAGACCCGGGCAGCTTGGGTCCCCCAGGGCCCCAGGGGCCTCAGGGGCAG
CCCGGGGATACCGGACCGGTGGGAGAAAGGGGGCCAGTGGGCCTGCGAGGTTTCCCAGGACTCAAAGGCTCGAAGGGCAGCTTCGGAACTGGAGGCCCCA
GAGGACAGCCAGGCCCCAAAGGGGATGTGGGGCCCCCAGGGCCTGAGGGGCCCCCAGGGTCGCCTGGGCCAGAGGGGCCTCAAGGAAAACCAGGCATCGC
CGGGAAGACAGGGTCACCAGGCCAGCGGGGACCTGTAGGGCCTAAGGGTGAACCAGGGATCCAGGGTCCCCCTGGCCTCCCTGGTCCCCCAGGTCCACCA
GGAAGCCAGAGCCACTACTGA


>BGISUSP0000890367
------------------------------------RPGPRCSRCQRNLSLHTSVRILYLFLALLLVAVAVLASL-FRKVDSLSEDISLAQAIYDKKLVS
MQENLQGL-LKAPNNCSFCYEAGQLGQEIRKLQEELEGIQKMLLAQEVQLDQASQTQELLSTTSGQISQEMGSCSFSIHQVNQSLGLFLAQVKGWQTTTA
SLDLSLKDLTQECYDVKAAMHQINFTVGQTSEWIHGIRRKTDEETLTLQKMVTDWQNYTRLFSSLRTTSAKTGEAVKNIQATLGVSSQRISQNAESMHDL
VLQVMGLQLQLDNISSFLDDHEENMHDLQYHTRYAQNRTVERFETLEGRMASHEIEIGTIFTNINATDSHVYSMLKYLDDVRLSCTLGFHTHAEELYYLN
KSVSLML--------------------------------------------------APGPPGPRGLKGDVGVKGPTGSRGPKGDPGSLGPPGPQGPQGQ
PGDTGPVGERGPVGLRGFPGLKGSKGSFGTGGPRGQPGPKGDVGPPGPEGPPGSPGPEGPQGKPGIAGKTGSPGQRGPVGPKGEPGIQGPPGLPGPPGPP
GSQSHY*