Sequences
EST Library Info
ebs2Foetus 50 days, brain stem
eep1Foetus 50 days, epidermis
eje1Foetus 50 days, jejunum
eye2Foetus 50 days, Eye
nca1Newborn 115 days, cartillage
pigcb1Unavailable
sin1Small intestine
spl1Spleen
Clusters
Oligos
SNPs

Gene ID ENSG00000168078 (click for geneview)
Transcript ID ENST00000301905(link to ensembl)
Symbol PBK
Localtion Chromosome:8:27723059:27751268:-1 band: 8p21.1
Description T-lymphokine-activated killer cell-originated protein kinase (EC 2.7.1.37) (T-LAK cell-originated protein kinase) (PDZ-binding kinase) (Spermatogenesis-related protein kinase) (SPK) (MAPKK-like protein kinase) (Nori-3). [Source:Uniprot/SWISSPROT;Acc:Q96KB5]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<--------------------------------------------------------><-----------------------------------------
-M--E--G--I--S--N--F--K--T--P--S--K--L--S--E--K--K--K--S--V--L--C--S--T--P--T--I--N--I--P--A--S--P--
ATGGAAGGGATCAGTAATTTCAAGACACCAAGCAAATTATCAGAAAAAAAGAAATCTGTATTATGTTCAACTCCAACTATAAATATCCCGGCCTCTCCGT
:::::::..: ::::::::::::::::::::::::.::::: ::::::::::::      ::.::::.:::::::  ::::::.::.:: ::::::::::
ATGGAAGAAAGCAGTAATTTCAAGACACCAAGCAAGTTATCCGAAAAAAAGAAA------TTGTGTTTAACTCCATGTATAAACATTCCTGCCTCTCCGT
-M--E--E--S--S--N--F--K--T--P--S--K--L--S--E--K--K--K--------L--C--L--T--P--C--I--N--I--P--A--S--P--

---------------------------------------------------><-----------------------------------------------
F--M--Q--K--L--G--F--G--T--G--V--N--V--Y--L--M--K--R--S--P--R--G--L--S--H--S--P--W--A--V--K--K--I--N
TTATGCAGAAGCTTGGCTTTGGTACTGGGGTAAATGTGTACCTAATGAAAAGATCTCCAAGAGGTTTGTCTCATTCTCCTTGGGCTGTAAAAAAGATTAA
:::::::::::::::::: :::::::::.:::::::: ::::: ::::::   :::::::::::::::::::::::::::::::::::.:::::::::::
TTATGCAGAAGCTTGGCTATGGTACTGGAGTAAATGTCTACCTTATGAAA---TCTCCAAGAGGTTTGTCTCATTCTCCTTGGGCTGTGAAAAAGATTAA
F--M--Q--K--L--G--Y--G--T--G--V--N--V--Y--L--M--K-----S--P--R--G--L--S--H--S--P--W--A--V--K--K--I--N

----------------------------------------------------------------------------------------------><----
--P--I--C--N--D--H--Y--R--S--V--Y--Q--K--R--L--M--D--E--A--K--I--L--K--S--L--H--H--P--N--I--V--G--Y-
TCCTATATGTAATGATCATTATCGAAGTGTGTATCAAAAGAGACTAATGGATGAAGCTAAGATTTTGAAAAGCCTTCATCATCCAAACATTGTTGGTTAT
::::: ::::::::::.::::::..:::.::::::::::::::::.:. ::::::::::::::::::::::::::: ::::::::::.:::      ::.
TCCTAGATGTAATGATTATTATCAGAGTATGTATCAAAAGAGACTGACTGATGAAGCTAAGATTTTGAAAAGCCTTAATCATCCAAATATT------TAC
--P--R--C--N--D--Y--Y--Q--S--M--Y--Q--K--R--L--T--D--E--A--K--I--L--K--S--L--N--H--P--N--I--------Y-

----------------------------------------------------------------------------------------------------
-R--A--F--T--E--A--N--D--G--S--L--C--L--A--M--E--Y--G--G--E--K--S--L--N--D--L--I--E--E--R--Y--K--A--
CGTGCTTTTACTGAAGCCAATGATGGCAGTCTGTGTCTTGCTATGGAATATGGAGGTGAAAAGTCTCTAAATGACTTAATAGAAGAACGATATAAAGCCA
:::::::::::::::::::..:::::.:::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::: :::::: .:
CGTGCTTTTACTGAAGCCAGCGATGGTAGTCTGTGTCTTGCTATGGAATATGGAGGTGAAAAGTCTCTGAATGACTTAATAGAAGAACGAAATAAAGATA
-R--A--F--T--E--A--S--D--G--S--L--C--L--A--M--E--Y--G--G--E--K--S--L--N--D--L--I--E--E--R--N--K--D--

----------------------------------------------------------------><----------------------------------
S--Q--D--P--F--P--A--A--I--I--L--K--V--A--L--N--M--A--R--G--L--K--Y--L--H--Q--E--K--K--L--L--H--G--D
GCCAAGATCCTTTTCCAGCAGCCATAATTTTAAAAGTTGCTTTGAATATGGCAAGAGGGTTAAAGTATCTGCACCAAGAAAAGAAACTGCTTCATGGAGA
:::::::::::::::::::::::::::::::::::::::: :::::.:::::::::::::::::::::::::::::::::::::::::::::::::::::
GCCAAGATCCTTTTCCAGCAGCCATAATTTTAAAAGTTGCGTTGAACATGGCAAGAGGGTTAAAGTATCTGCACCAAGAAAAGAAACTGCTTCATGGAGA
S--Q--D--P--F--P--A--A--I--I--L--K--V--A--L--N--M--A--R--G--L--K--Y--L--H--Q--E--K--K--L--L--H--G--D

----------------------------------------------------------------------------------------------><----
--I--K--S--S--N--V--V--I--K--G--D--F--E--T--I--K--I--C--D--V--G--V--S--L--P--L--D--E--N--M--T--V--T-
CATAAAGTCTTCAAATGTTGTAATTAAAGGCGATTTTGAAACAATTAAAATCTGTGATGTAGGAGTCTCTCTACCACTGGATGAAAATATGACTGTGACT
.:::::::::::::::::::: ::::::::.::::::::::::::::::::::::::::::.::::::::::::::.:::::::::::::::::   :::
TATAAAGTCTTCAAATGTTGTTATTAAAGGTGATTTTGAAACAATTAAAATCTGTGATGTAAGAGTCTCTCTACCATTGGATGAAAATATGACT---ACT
--I--K--S--S--N--V--V--I--K--G--D--F--E--T--I--K--I--C--D--V--R--V--S--L--P--L--D--E--N--M--T-----T-

----------------------------------------------------------------------------------------------------
-D--P--E--A--C--Y--I--G--T--E--P--W--K--P--K--E--A--V--E--E--N--G--V--I--T--D--K--A--D--I--F--A--F--
GACCCTGAGGCTTGTTACATTGGCACAGAGCCATGGAAACCCAAAGAAGCTGTGGAGGAGAATGGTGTTATTACTGACAAGGCAGACATATTTGCCTTTG
::::: :::::.:.::::::.::::: ::::: ::::::::.::.:::::: :.:::::.::::::.:::::::::::::::::::::::::::::::::
GACCCAGAGGCCTATTACATCGGCACTGAGCCTTGGAAACCTAAGGAAGCTCTAGAGGAAAATGGTATTATTACTGACAAGGCAGACATATTTGCCTTTG
-D--P--E--A--Y--Y--I--G--T--E--P--W--K--P--K--E--A--L--E--E--N--G--I--I--T--D--K--A--D--I--F--A--F--

-----------------------------------------------------------------------><---------------------------
G--L--T--L--W--E--M--M--T--L--S--I--P--H--I--N--L--S--N--D--D--D--D--E--D--K--T--F--D--E--S--D--F--D
GCCTTACTTTGTGGGAAATGATGACTTTATCGATTCCACACATTAATCTTTCAAATGATGATGATGATGAAGATAAAACTTTTGATGAAAGTGATTTTGA
::::::::.:::::::::::::::::::::: :::::::::::::.::::.::.:::::::::::         ::.:::::::::::::::::.:::::
GCCTTACTCTGTGGGAAATGATGACTTTATCTATTCCACACATTAGTCTTCCAGATGATGATGAT---------AAGACTTTTGATGAAAGTGACTTTGA
G--L--T--L--W--E--M--M--T--L--S--I--P--H--I--S--L--P--D--D--D--D-----------K--T--F--D--E--S--D--F--D

----------------------------------------------------------------------------------------------------
--D--E--A--Y--Y--A--A--L--G--T--R--P--P--I--N--M--E--E--L--D--E--S--Y--Q--K--V--I--E--L--F--S--V--C-
TGATGAAGCATACTATGCAGCGTTGGGAACTAGGCCACCTATTAATATGGAAGAACTGGATGAATCATACCAGAAAGTAATTGAACTCTTCTCTGTATGC
::::::::::::::::::::: ::::::::: :::::::::::::::::::::::.:::::: : :.::::::::.::::::::.:::::::::::::::
TGATGAAGCATACTATGCAGCCTTGGGAACTCGGCCACCTATTAATATGGAAGAATTGGATGCAACGTACCAGAAGGTAATTGAGCTCTTCTCTGTATGC
--D--E--A--Y--Y--A--A--L--G--T--R--P--P--I--N--M--E--E--L--D--A--T--Y--Q--K--V--I--E--L--F--S--V--C-

-------------------------------------------------------------------->
-T--N--E--D--P--K--D--R--P--S--A--A--H--I--V--E--A--L--E--T--D--V--*-
ACTAATGAAGACCCTAAAGATCGTCCTTCTGCTGCACACATTGTTGAAGCTCTGGAAACAGATGTCTAG
::.::::::::::::::.:::::.:::::::::::.::::::::::  :::.::::::..::::::   
ACCAATGAAGACCCTAAGGATCGCCCTTCTGCTGCGCACATTGTTGCCGCTTTGGAAATGGATGTC---
-T--N--E--D--P--K--D--R--P--S--A--A--H--I--V--A--A--L--E--M--D--V----

Pig Consensus Sequence

>BGISUST0000884544
ATGGAAGAAAGCAGTAATTTCAAGACACCAAGCAAGTTATCCGAAAAAAAGAAA------TTGTGTTTAACTCCATGTATAAACATTCCTGCCTCTCCGT
TTATGCAGAAGCTTGGCTATGGTACTGGAGTAAATGTCTACCTTATGAAA---TCTCCAAGAGGTTTGTCTCATTCTCCTTGGGCTGTGAAAAAGATTAA
TCCTAGATGTAATGATTATTATCAGAGTATGTATCAAAAGAGACTGACTGATGAAGCTAAGATTTTGAAAAGCCTTAATCATCCAAATATT------TAC
CGTGCTTTTACTGAAGCCAGCGATGGTAGTCTGTGTCTTGCTATGGAATATGGAGGTGAAAAGTCTCTGAATGACTTAATAGAAGAACGAAATAAAGATA
GCCAAGATCCTTTTCCAGCAGCCATAATTTTAAAAGTTGCGTTGAACATGGCAAGAGGGTTAAAGTATCTGCACCAAGAAAAGAAACTGCTTCATGGAGA
TATAAAGTCTTCAAATGTTGTTATTAAAGGTGATTTTGAAACAATTAAAATCTGTGATGTAAGAGTCTCTCTACCATTGGATGAAAATATGACT---ACT
GACCCAGAGGCCTATTACATCGGCACTGAGCCTTGGAAACCTAAGGAAGCTCTAGAGGAAAATGGTATTATTACTGACAAGGCAGACATATTTGCCTTTG
GCCTTACTCTGTGGGAAATGATGACTTTATCTATTCCACACATTAGTCTTCCAGATGATGATGAT---------AAGACTTTTGATGAAAGTGACTTTGA
TGATGAAGCATACTATGCAGCCTTGGGAACTCGGCCACCTATTAATATGGAAGAATTGGATGCAACGTACCAGAAGGTAATTGAGCTCTTCTCTGTATGC
ACCAATGAAGACCCTAAGGATCGCCCTTCTGCTGCGCACATTGTTGCCGCTTTGGAAATGGATGTC---


>BGISUSP0000884544
MEESSNFKTPSKLSEKKK--LCLTPCINIPASPFMQKLGYGTGVNVYLMK-SPRGLSHSPWAVKKINPRCNDYYQSMYQKRLTDEAKILKSLNHPNI--Y
RAFTEASDGSLCLAMEYGGEKSLNDLIEERNKDSQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVRVSLPLDENMT-T
DPEAYYIGTEPWKPKEALEENGIITDKADIFAFGLTLWEMMTLSIPHISLPDDDD---KTFDESDFDDEAYYAALGTRPPINMEELDATYQKVIELFSVC
TNEDPKDRPSAAHIVAALEMDV-