Sequences
EST Library Info
ebs1Foetus 50 days, brain stem
Clusters
Oligos
SNPs

Gene ID ENSG00000168081 (click for geneview)
Transcript ID ENST00000301908(link to ensembl)
Symbol PNOC
Localtion Chromosome:8:28230568:28256786:1 band: 8p21.1
Description Nociceptin precursor (Orphanin FQ) (PPNOC). [Source:Uniprot/SWISSPROT;Acc:Q13519]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--K--V--L--L--C--D--L--L--L--L--S--L--F--S--S--V--F--S--S--C--Q--R--D--C--L--T--C--Q--E--K--L--H--
ATGAAAGTCCTGCTTTGTGACCTGCTGCTGCTCAGTCTCTTCTCCAGTGTGTTCAGCAGTTGTCAGAGGGACTGTCTCACATGCCAGGAGAAGCTCCACC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------><-------------------------------------------------------------------------
P--A--L--D--S--F--D--L--E--V--C--I--L--E--C--E--E--K--V--F--P--S--P--L--W--T--P--C--T--K--V--M--A--R
CAGCCCTGGACAGCTTCGACCTGGAGGTGTGCATCCTCGAGTGTGAAGAGAAGGTCTTCCCCAGCCCCCTCTGGACTCCATGCACCAAGGTCATGGCCAG
                          ::::::::::::::::::::::.:::::::::: ::::.::::::::::::::::::::::::::::::::::.
--------------------------GTGTGCATCCTCGAGTGTGAAGGGAAGGTCTTCACCAGTCCCCTCTGGACTCCATGCACCAAGGTCATGGCCAA
---------------------------V--C--I--L--E--C--E--G--K--V--F--T--S--P--L--W--T--P--C--T--K--V--M--A--K

----------------------------------------------------------------------------------------------------
-----S--S--W--Q--L--S--P--A--A--P--E--H--V--A--A--A--L--Y--Q--P--R--A--S--E--M--Q--H--L--R--R--M--P-
G---AGCTCTTGGCAGCTCAGCCCTGCCGCCCCAGAGCATGTGGCGGCTGCTCTCTACCAGCCGAGAGCTTCGGAGATGCAGCATCTGCGGCGAATGCCC
.     :::.::::::::::::::::::: :::::: ::.::::::::..::::.::::::::.:::::.:: ::::::::::::::: .:::.::::::
AGGCTCCTCCTGGCAGCTCAGCCCTGCCGACCCAGACCACGTGGCGGCCACTCTTTACCAGCCAAGAGCCTCTGAGATGCAGCATCTGAAGCGGATGCCC
--G--S--S--W--Q--L--S--P--A--D--P--D--H--V--A--A--T--L--Y--Q--P--R--A--S--E--M--Q--H--L--K--R--M--P-

----------------------------------------------------------------------------------------------------
-R--V--R--S--L--F--Q--E--Q--E--E--P--E--P--G--M--E--E--A--G--E--M--E--Q--K--Q--L--Q--K--R--F--G--G--
CGAGTCCGGAGCTTGTTCCAGGAGCAGGAAGAGCCCGAGCCTGGCATGGAGGAGGCTGGTGAGATGGAGCAGAAGCAGCTGCAGAAGAGATTTGGGGGCT
:: :::::::::.: :::::.:  :::::::.: ::.::::.:::::::: :::::::: :.::.::::::::::::::::::::::::.::.:::::::
CGTGTCCGGAGCCTCTTCCAAGCCCAGGAAGGGACCAAGCCCGGCATGGATGAGGCTGGAGGGACGGAGCAGAAGCAGCTGCAGAAGAGGTTCGGGGGCT
-R--V--R--S--L--F--Q--A--Q--E--G--T--K--P--G--M--D--E--A--G--G--T--E--Q--K--Q--L--Q--K--R--F--G--G--

----------------------------------------------------------------------------------------------------
F--T--G--A--R--K--S--A--R--K--L--A--N--Q--K--R--F--S--E--F--M--R--Q--Y--L--V--L--S--M--Q--S--S--Q--R
TCACCGGGGCCCGGAAGTCGGCCAGGAAGTTGGCCAATCAGAAGCGGTTCAGTGAGTTTATGAGGCAATACTTGGTCCTGAGCATGCAGTCCAGCCAGCG
:::: :::::::::::::::::: :::::::::::::.::.::::::::::::::::::::::::::.:::.::::::::::: ::::::::::::::::
TCACGGGGGCCCGGAAGTCGGCCCGGAAGTTGGCCAACCAAAAGCGGTTCAGTGAGTTTATGAGGCAGTACCTGGTCCTGAGCCTGCAGTCCAGCCAGCG
F--T--G--A--R--K--S--A--R--K--L--A--N--Q--K--R--F--S--E--F--M--R--Q--Y--L--V--L--S--L--Q--S--S--Q--R

--------------------------------->
--R--R--T--L--H--Q--N--G--N--V--*-
CCGGCGCACCCTGCACCAGAATGGTAATGTGTAG
:::::::::::::::::::::::::::::.::::
CCGGCGCACCCTGCACCAGAATGGTAATGCGTAG
--R--R--T--L--H--Q--N--G--N--A--*-

Pig Consensus Sequence

>BGISUST0000887876
----------------------------------------------------------------------------------------------------
--------------------------GTGTGCATCCTCGAGTGTGAAGGGAAGGTCTTCACCAGTCCCCTCTGGACTCCATGCACCAAGGTCATGGCCAA
AGGCTCCTCCTGGCAGCTCAGCCCTGCCGACCCAGACCACGTGGCGGCCACTCTTTACCAGCCAAGAGCCTCTGAGATGCAGCATCTGAAGCGGATGCCC
CGTGTCCGGAGCCTCTTCCAAGCCCAGGAAGGGACCAAGCCCGGCATGGATGAGGCTGGAGGGACGGAGCAGAAGCAGCTGCAGAAGAGGTTCGGGGGCT
TCACGGGGGCCCGGAAGTCGGCCCGGAAGTTGGCCAACCAAAAGCGGTTCAGTGAGTTTATGAGGCAGTACCTGGTCCTGAGCCTGCAGTCCAGCCAGCG
CCGGCGCACCCTGCACCAGAATGGTAATGCG


>BGISUSP0000887876
------------------------------------------VCILECEGKVFTSPLWTPCTKVMAKGSSWQLSPADPDHVAATLYQPRASEMQHLKRMP
RVRSLFQAQEGTKPGMDEAGGTEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSLQSSQRRRTLHQNGNA