Sequences
EST Library Info
Clusters
Oligos
SNPs

Gene ID ENSG00000170011 (click for geneview)
Transcript ID ENST00000302541(link to ensembl)
Symbol MYRIP
Localtion Chromosome:3:39917312:40276460:1 band: 3p22.1
Description Rab effector MyRIP (Myosin-VIIa- and Rab-interacting protein) (Exophilin 8) (Slp homolog lacking C2 domains-c). [Source:Uniprot/SWISSPROT;Acc:Q8NFW9]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--G--R--K--L--D--L--S--G--L--T--D--D--E--T--E--H--V--L--Q--V--V--Q--R--D--F--N--L--R--K--K--E--E--
ATGGGGAGGAAGCTGGACCTGTCTGGTTTGACTGATGATGAAACAGAGCATGTTCTTCAGGTGGTTCAAAGAGACTTCAATCTTCGCAAAAAAGAAGAAG
                                          ::::::::::::::.::::::::.::. :::::::::::::.:: ::::::::.::::
------------------------------------------ACAGAGCATGTTCTCCAGGTGGTCCAGCGAGACTTCAATCTCCGAAAAAAAGAGGAAG
-------------------------------------------T--E--H--V--L--Q--V--V--Q--R--D--F--N--L--R--K--K--E--E--

---------><-----------------------------------------------------------------------------------------
E--R--L--S--E--L--K--Q--K--L--D--E--E--G--S--K--C--S--I--L--S--K--H--Q--Q--F--V--E--H--C--C--M--R--C
AACGACTAAGTGAGCTGAAGCAGAAGCTGGATGAGGAAGGCAGCAAGTGCAGCATCCTCTCGAAGCACCAGCAGTTTGTGGAGCACTGCTGCATGCGCTG
:.:::                                                                                               
AGCGA-----------------------------------------------------------------------------------------------
E--R------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--C--S--P--F--T--F--L--V--N--T--K--R--Q--C--G--D--C--K--F--N--V--C--K--S--C--C--S--Y--Q--K--H--E--K-
CTGCTCGCCCTTCACCTTCCTCGTCAACACCAAGCGCCAGTGTGGAGATTGCAAATTCAATGTCTGCAAGAGCTGCTGCTCCTACCAGAAGCACGAAAAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------><-------------------------------------------------------------------
-A--W--V--C--C--V--C--Q--Q--A--R--L--L--R--A--Q--S--L--E--W--F--Y--N--N--V--K--S--R--F--K--R--F--G--
GCCTGGGTCTGCTGCGTCTGCCAGCAAGCGAGGCTTCTGAGGGCCCAATCTCTGGAATGGTTCTACAATAATGTGAAGAGCCGCTTCAAGCGCTTTGGCA
                                  ::::.:::.::::.:::::::::::::::::::.:::::::::::::::::::::.:::::::: :
---------------------------------GTTCTAAGGACCCAGTCTCTGGAATGGTTCTACAGTAATGTGAAGAGCCGCTTCAAACGCTTTGGAA
----------------------------------V--L--R--T--Q--S--L--E--W--F--Y--S--N--V--K--S--R--F--K--R--F--G--

--------------------------------------------------------------------><------------------------------
S--A--K--V--L--K--N--L--Y--R--K--H--R--L--E--S--G--A--C--F--D--I--L--G--G--S--L--F--E--S--N--L--E--N
GTGCCAAGGTTCTGAAGAACCTGTACAGGAAGCACCGGCTGGAGAGTGGCGCGTGCTTCGACATTCTAGGAGGAAGCCTTTTTGAGTCAAACCTGGAGAA
:.::::::::..:::::::::::::: ::::.: ::::::::::::.:: :.:::.::.:::::.      ::::::.:::::::: ::: :::::::::
GCGCCAAGGTCTTGAAGAACCTGTACTGGAAACTCCGGCTGGAGAGCGGAGTGTGTTTTGACATC------GGAAGCTTTTTTGAGGCAACCCTGGAGAA
S--A--K--V--L--K--N--L--Y--W--K--L--R--L--E--S--G--V--C--F--D--I--------G--S--F--F--E--A--T--L--E--N

-------------------------------------------------><-------------------------------------------------
--E--G--S--I--S--G--S--D--S--T--F--Y--R--Q--S--E--G--H--S--V--M--D--T--L--A--V--A--L--R--V--A--E--E-
TGAAGGAAGCATTTCTGGCAGTGATTCAACATTTTATAGGCAGTCAGAAGGACATAGTGTGATGGACACCTTGGCTGTGGCCCTACGGGTGGCTGAAGAG
:::::: ::.::::: ::::::::.::::: :::::.::::::::::::   :::::..:::::::::: .::::::: ::::: ::::::::::::::.
TGAAGGCAGTATTTCAGGCAGTGACTCAACCTTTTACAGGCAGTCAGAA---CATAGCATGATGGACACACTGGCTGTCGCCCTCCGGGTGGCTGAAGAA
--E--G--S--I--S--G--S--D--S--T--F--Y--R--Q--S--E-----H--S--M--M--D--T--L--A--V--A--L--R--V--A--E--E-

--------------------------------------------------><------------------------------------------------
-A--I--E--E--A--I--S--K--A--E--A--Y--G--D--S--L--D--K--Q--N--E--A--S--Y--L--R--D--H--K--E--E--L--T--
GCCATTGAGGAAGCAATTTCCAAAGCAGAGGCATATGGGGACAGCCTGGACAAGCAAAATGAGGCCAGTTACCTGCGGGACCACAAGGAGGAGCTAACTG
:::::.::::::::::::::::: :::::.:: :::::::::::::::                                                    
GCCATCGAGGAAGCAATTTCCAA-GCAGAAGCCTATGGGGACAGCCTG----------------------------------------------------
-A--I--E--E--A--I--S--K--A--E--A--Y--G--D--S--L-----------------------------------------------------

-------------------------------><-------------------------------------------------------------------
E--E--L--A--T--T--I--L--Q--K--I--I--R--K--Q--K--S--K--S--E--Q--Q--V--E--E--E--P--G--W--P--H--P--Q--S
AGGAACTGGCCACGACAATCCTGCAGAAGATTATACGAAAACAGAAGAGCAAAAGTGAGCAGCAAGTGGAAGAAGAGCCAGGATGGCCACATCCCCAGAG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

---------------------------------------------------------------------------><-----------------------
--C--S--T--K--V--A--D--E--G--T--S--A--S--P--G--G--Y--R--A--P--A--A--L--W--R--S--Q--S--A--F--S--I--T-
TTGCAGCACAAAGGTGGCAGATGAGGGGACCTCAGCATCCCCTGGAGGCTACCGTGCTCCCGCTGCCCTCTGGAGGTCCCAGTCTGCCTTCTCAATCACT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-G--E--E--A--L--K--T--P--P--V--E--A--P--S--R--Q--P--R--D--Q--G--Q--H--P--R--A--E--S--A--L--P--S--W--
GGAGAAGAAGCCCTGAAGACCCCTCCAGTGGAGGCTCCATCGAGGCAGCCAAGGGACCAAGGCCAACACCCGAGAGCAGAGTCTGCTCTGCCCAGCTGGA
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-----------------------------><---------------------------------------------------------------------
K--S--V--D--R--L--D--E--T--N--L--A--P--V--L--Q--S--P--D--G--N--W--V--A--L--K--D--G--A--P--P--P--T--R
AGAGTGTGGACAGGCTGGATGAAACAAACCTGGCCCCAGTTTTGCAGAGCCCCGACGGGAACTGGGTGGCCCTGAAGGATGGCGCTCCACCCCCCACCCG
                                ::::::::::::::::::::.::.:::::::::.::::::: :::::::: ::::..::::: :::::
--------------------------------GCCCCAGTTTTGCAGAGCCCTGATGGGAACTGGATGGCCCTCAAGGATGGGGCTCTGCCCCCGACCCG
---------------------------------A--P--V--L--Q--S--P--D--G--N--W--M--A--L--K--D--G--A--L--P--P--T--R

----------------------------------------------------------------------------------------------------
--L--L--A--K--P--K--S--G--T--F--Q--A--L--E--V--A--S--S--V--A--S--A--Y--D--E--M--G--S--D--S--E--E--D-
ACTACTGGCCAAACCTAAGAGCGGGACGTTTCAGGCCCTGGAGGTGGCCTCCAGTGTGGCATCTGCCTACGATGAGATGGGCTCCGATAGCGAGGAAGAC
 ::.::::.::::::::::::::: :: ::::::::::::::::..:::::::::::::::::::::::.:::::::::::::::::.::.:::::::::
CCTGCTGGTCAAACCTAAGAGCGGCACCTTTCAGGCCCTGGAGGCAGCCTCCAGTGTGGCATCTGCCTATGATGAGATGGGCTCCGACAGTGAGGAAGAC
--L--L--V--K--P--K--S--G--T--F--Q--A--L--E--A--A--S--S--V--A--S--A--Y--D--E--M--G--S--D--S--E--E--D-

----------------------------------------------------------------------------------------------------
-F--D--W--S--E--A--L--S--K--L--C--P--R--S--R--A--L--P--R--N--P--Q--P--Q--P--T--Q--A--Q--S--S--D--Q--
TTTGACTGGAGTGAGGCCTTGAGCAAGCTGTGTCCCAGGTCCCGGGCCCTGCCCAGGAACCCCCAGCCTCAGCCCACACAGGCCCAGAGCTCTGACCAAG
::::::::::: :::                                                                                     
TTTGACTGGAGGGAG-------------------------------------------------------------------------------------
-F--D--W--R--E--------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
G--P--I--A--A--S--P--S--S--A--L--S--P--N--P--E--A--M--C--S--D--S--E--T--S--S--A--G--S--S--R--E--V--G
GCCCCATAGCTGCCTCCCCATCCTCTGCACTCTCCCCCAACCCTGAGGCCATGTGCTCTGACTCGGAGACCTCCTCCGCAGGCTCTTCCCGAGAAGTTGG
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--H--Q--A--R--L--S--W--L--Q--R--K--A--P--R--N--P--A--A--E--K--M--R--L--H--G--E--L--D--V--N--F--N--P-
GCACCAGGCCAGACTGTCCTGGTTGCAGAGGAAGGCCCCCAGGAACCCTGCAGCTGAGAAGATGCGCTTGCATGGAGAGCTGGACGTGAACTTCAACCCC
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
-Q--L--A--S--R--E--T--S--D--S--S--E--P--E--E--A--P--H--T--T--D--R--R--A--R--R--W--R--R--A--R--L--G--
CAGTTGGCCAGCAGGGAGACCTCGGACAGCAGCGAGCCGGAGGAGGCCCCCCACACCACAGACCGGCGGGCCAGGAGGTGGAGAAGAGCCCGACTGGGCT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

-------------------------------------------------------------------><-------------------------------
S--E--E--P--S--K--E--P--S--S--P--S--A--Q--L--R--D--L--D--T--H--Q--V--S--D--D--L--S--E--T--D--I--S--N
CAGAAGAGCCAAGCAAAGAACCATCTTCCCCCAGCGCCCAGCTCCGGGATCTAGACACACATCAGGTGTCGGATGATTTATCAGAGACAGACATCAGCAA
                                                                 :::::::.::::::::::::::: ::::::::::.
-----------------------------------------------------------------GTGTCGGGTGATTTATCAGAGACTGACATCAGCAG
------------------------------------------------------------------V--S--G--D--L--S--E--T--D--I--S--S

----------------------------------------------------------------------------------------------------
--E--A--R--D--P--Q--T--L--T--D--T--T--E--E--K--R--R--N--R--L--Y--E--L--A--M--K--M--S--E--K--E--T--S-
TGAGGCTCGGGATCCCCAGACTCTCACAGACACCACAGAGGAGAAACGGAGAAACAGGCTGTACGAGTTAGCAATGAAAATGAGTGAAAAGGAGACTTCT
::::::: :: :.: : .: :.  :::.:::::  ::::: :::::: :::::::::::::::::::::.:::::::::::::::::.::::::::::::
TGAGGCTAGGCACCGCAGGTCCAGCACGGACACATCAGAGCAGAAACTGAGAAACAGGCTGTACGAGTTGGCAATGAAAATGAGTGAGAAGGAGACTTCT
--E--A--R--H--R--R--S--S--T--D--T--S--E--Q--K--L--R--N--R--L--Y--E--L--A--M--K--M--S--E--K--E--T--S-

----------------------------------------------------------------------------------------------------
-S--G--E--D--Q--E--S--E--P--K--T--E--S--E--N--Q--K--E--S--L--S--S--E--D--N--S--Q--S--V--Q--E--E--L--
TCAGGGGAGGATCAGGAGTCTGAGCCCAAGACAGAATCTGAGAACCAGAAGGAAAGTCTGTCCTCTGAAGACAACAGCCAGAGTGTCCAGGAAGAGCTGA
:: :::::::: :::::::::::::::::.:::::.::::::::::::::::::::::::::.:::::::: :::::::::::.::::::::::::::::
TCTGGGGAGGAACAGGAGTCTGAGCCCAAAACAGAGTCTGAGAACCAGAAGGAAAGTCTGTCTTCTGAAGAGAACAGCCAGAGCGTCCAGGAAGAGCTGA
-S--G--E--E--Q--E--S--E--P--K--T--E--S--E--N--Q--K--E--S--L--S--S--E--E--N--S--Q--S--V--Q--E--E--L--

-------><-------------------------------------------------------------------------------------------
K--K--K--F--S--A--V--S--L--C--N--I--S--T--E--V--L--K--V--I--N--A--T--E--E--L--I--A--G--S--T--G--P--W
AGAAGAAGTTTTCTGCTGTTTCTCTCTGCAACATCTCCACAGAAGTCCTGAAAGTCATCAATGCCACAGAGGAGTTGATAGCAGGATCTACAGGGCCCTG
:::::                                                                                               
AGAAG-----------------------------------------------------------------------------------------------
K--K------------------------------------------------------------------------------------------------

----------------------------------------------------------------------------------------------------
--E--S--P--Q--V--P--P--D--R--Q--K--G--M--F--P--R--G--T--D--Q--V--R--L--D--E--Q--L--T--S--L--E--E--N-
GGAGTCCCCACAAGTCCCTCCTGACAGACAGAAGGGGATGTTTCCTCGTGGGACAGACCAAGTGAGACTGGATGAGCAGCTGACTTCCCTGGAAGAAAAT
                                                                                                    
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------

--><------------------------------------------------------------------------------------------------
-V--Y--L--A--A--G--T--V--Y--G--L--E--T--Q--L--T--E--L--E--D--A--A--R--C--I--H--S--G--T--D--E--T--H--
GTATACCTGGCAGCAGGCACTGTGTATGGACTGGAGACCCAGCTGACTGAGCTAGAAGATGCCGCCCGCTGCATCCACAGTGGCACTGATGAGACCCATC
::.::::::::.:::::::::::::::::::: ::.. ::::::.: :::::::::.::::::::::::::::::::::::::::::::::::::. : :
GTGTACCTGGCGGCAGGCACTGTGTATGGACTCGAAGGCCAGCTAAGTGAGCTAGAGGATGCCGCCCGCTGCATCCACAGTGGCACTGATGAGACTGAAC
-V--Y--L--A--A--G--T--V--Y--G--L--E--G--Q--L--S--E--L--E--D--A--A--R--C--I--H--S--G--T--D--E--T--E--

----------------------------------------------------------------><----------------------------------
L--A--D--L--E--D--Q--V--A--T--A--A--A--Q--V--H--H--A--E--L--Q--I--S--D--I--E--S--R--I--S--A--L--T--I
TGGCGGATCTGGAGGACCAGGTGGCCACGGCTGCAGCCCAAGTCCACCATGCTGAACTCCAGATTTCAGATATTGAGAGCCGGATTTCAGCCCTGACCAT
::::.::::::::::::::.::::::::::: :: :::::.::::::::.:::::. :::::::::: :::::::::::: :::::::::: ::::::::
TGGCAGATCTGGAGGACCAAGTGGCCACGGCAGCTGCCCAGGTCCACCACGCTGAGATCCAGATTTCTGATATTGAGAGCAGGATTTCAGCACTGACCAT
L--A--D--L--E--D--Q--V--A--T--A--A--A--Q--V--H--H--A--E--I--Q--I--S--D--I--E--S--R--I--S--A--L--T--I

---------------------------------------------------------------------><-----------------------------
--A--G--L--N--I--A--P--C--V--R--F--T--R--R--R--D--Q--K--Q--R--T--Q--V--Q--T--I--D--T--S--R--Q--Q--R-
TGCAGGATTAAACATAGCACCATGTGTGCGCTTCACAAGAAGACGGGATCAGAAGCAAAGGACCCAGGTACAAACCATAGATACATCAAGGCAGCAAAGG
::::::::::::::::::::: ::.: ::::.:::::::::.:::.:::::::::::::::: ::::::::::::::::::.::.:::::::::::.:::
TGCAGGATTAAACATAGCACCCTGCGGGCGCCTCACAAGAAAACGAGATCAGAAGCAAAGGAACCAGGTACAAACCATAGACACGTCAAGGCAGCAGAGG
--A--G--L--N--I--A--P--C--G--R--L--T--R--K--R--D--Q--K--Q--R--N--Q--V--Q--T--I--D--T--S--R--Q--Q--R-

------------------------------><--------------------------------------------------------------------
-R--K--L--P--A--P--P--V--K--A--E--K--I--E--T--S--S--V--T--T--I--K--T--F--N--H--N--F--I--L--Q--G--S--
AGGAAACTGCCTGCTCCACCGGTGAAAGCTGAAAAAATTGAGACATCTTCAGTGACTACCATTAAAACATTTAACCACAACTTCATTCTCCAAGGCTCCT
:::::::::::::::::::: ::::::   :::::::. :::.:::::::::.:::.:::::::::::::::::::.:::::::::::::::::.:::::
AGGAAACTGCCTGCTCCACCTGTGAAA---GAAAAAACAGAGGCATCTTCAGCGACCACCATTAAAACATTTAACCGCAACTTCATTCTCCAAGACTCCT
-R--K--L--P--A--P--P--V--K-----E--K--T--E--A--S--S--A--T--T--I--K--T--F--N--R--N--F--I--L--Q--D--S--

-------------------------------------------------><-----------------------------
S--T--N--R--T--K--E--R--K--G--T--T--K--D--L--M--E--P--A--L--E--S--A--V--M--Y--*-
CAACAAACAGGACTAAGGAAAGGAAAGGCACCACCAAGGATTTGATGGAGCCTGCTCTGGAGTCAGCTGTGATGTACTGA
:::::::.::::::::.:::::::::.::::::::::::: ::::::                                 
CAACAAATAGGACTAAAGAAAGGAAAAGCACCACCAAGGAATTGATG---------------------------------
S--T--N--R--T--K--E--R--K--S--T--T--K--E--L--M----------------------------------

Pig Consensus Sequence

>BGISUST0000878109
------------------------------------------ACAGAGCATGTTCTCCAGGTGGTCCAGCGAGACTTCAATCTCCGAAAAAAAGAGGAAG
AGCGA-----------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
---------------------------------GTTCTAAGGACCCAGTCTCTGGAATGGTTCTACAGTAATGTGAAGAGCCGCTTCAAACGCTTTGGAA
GCGCCAAGGTCTTGAAGAACCTGTACTGGAAACTCCGGCTGGAGAGCGGAGTGTGTTTTGACATC------GGAAGCTTTTTTGAGGCAACCCTGGAGAA
TGAAGGCAGTATTTCAGGCAGTGACTCAACCTTTTACAGGCAGTCAGAA---CATAGCATGATGGACACACTGGCTGTCGCCCTCCGGGTGGCTGAAGAA
GCCATCGAGGAAGCAATTTCcgCAGAAGCCTATGGGGACAGCCTG-------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
-----------------------------GCCCCAGTTTTGCAGAGCCCTGATGGGAACTGGATGGCCCTCAAGGATGGGGCTCTGCCCCCGACCCGCCT
GCTGGTCAAACCTAAGAGCGGCACCTTTCAGGCCCTGGAGGCAGCCTCCAGTGTGGCATCTGCCTATGATGAGATGGGCTCCGACAGTGAGGAAGACTTT
GACTGGAGGGAG----------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------
--------------------------------------------------------------GTGTCGGGTGATTTATCAGAGACTGACATCAGCAGTGA
GGCTAGGCACCGCAGGTCCAGCACGGACACATCAGAGCAGAAACTGAGAAACAGGCTGTACGAGTTGGCAATGAAAATGAGTGAGAAGGAGACTTCTTCT
GGGGAGGAACAGGAGTCTGAGCCCAAAACAGAGTCTGAGAACCAGAAGGAAAGTCTGTCTTCTGAAGAGAACAGCCAGAGCGTCCAGGAAGAGCTGAAGA
AG--------------------------------------------------------------------------------------------------
-------------------------------------------------------------------------------------------------GTG
TACCTGGCGGCAGGCACTGTGTATGGACTCGAAGGCCAGCTAAGTGAGCTAGAGGATGCCGCCCGCTGCATCCACAGTGGCACTGATGAGACTGAACTGG
CAGATCTGGAGGACCAAGTGGCCACGGCAGCTGCCCAGGTCCACCACGCTGAGATCCAGATTTCTGATATTGAGAGCAGGATTTCAGCACTGACCATTGC
AGGATTAAACATAGCACCCTGCGGGCGCCTCACAAGAAAACGAGATCAGAAGCAAAGGAACCAGGTACAAACCATAGACACGTCAAGGCAGCAGAGGAGG
AAACTGCCTGCTCCACCTGTGAAA---GAAAAAACAGAGGCATCTTCAGCGACCACCATTAAAACATTTAACCGCAACTTCATTCTCCAAGACTCCTCAA
CAAATAGGACTAAAGAAAGGAAAAGCACCACCAAGGAATTGATG---------------------------------


>BGISUSP0000878109
--------------TEHVLQVVQRDFNLRKKEEER-----------------------------------------------------------------
-----------VLRTQSLEWFYSNVKSRFKRFGSAKVLKNLYWKLRLESGVCFDI--GSFFEATLENEGSISGSDSTFYRQSE-HSMMDTLAVALRVAEE
AIEEAISAEAYGDSL-------------------------------------------------------------------------------------
-------------------------------------------APVLQSPDGNWMALKDGALPPTRLLVKPKSGTFQALEAASSVASAYDEMGSDSEEDF
DWRE------------------------------------------------------------------------------------------------
------------------------------------------------------VSGDLSETDISSEARHRRSSTDTSEQKLRNRLYELAMKMSEKETSS
GEEQESEPKTESENQKESLSSEENSQSVQEELKK-----------------------------------------------------------------V
YLAAGTVYGLEGQLSELEDAARCIHSGTDETELADLEDQVATAAAQVHHAEIQISDIESRISALTIAGLNIAPCGRLTRKRDQKQRNQVQTIDTSRQQRR
KLPAPPVK-EKTEASSATTIKTFNRNFILQDSSTNRTKERKSTTKELM-----------