Sequences
CF791498est
rste26_d8.y1est
BP151116est
rmgm23_b3.y1est
rtes12_f9.y1est
risp30_l17.y1est
rova034_j5.y1est
rcki36_n18.y1est
BP450082est
rfat0116_o21.y1est
DN126558est
DY411396est
rute2114b_g2.y1est
relu1314b_g1.y1est
rcbe03_m8.y1est
CN153826est
DN126923est
DN120505est
risp24_d4.y1est
rtes26_e9.y1est
rnlu1821b_a10.y1est
CV874614est
DN106636est
rfat0108_m23.y1est
rmgp19_b24.y1est
CF792821est
rhlv15b_f19.y1est
rvin015_l10.y1est
CV865514est
DY435999est
rcst10_o18.y1est
BW977120est
CF361518est
CO942882est
CN156242est
rcst01_j6.y1est
CF366479est
reje11b_h16.y1est
rvin016_b15.y1est
rssp09_l17.y1est
rpldo0131_h12.y1est
DN131196est
BP454584est
CF795573est
rssp33_m9.y1est
rcmu19_m3.y1est
rfhi4025b_a11.y1est
rplun0122_a3.y1est
rpigca0_005978.y1est
CF794188est
CK462808est
BQ602171est
DN126555est
rpfco0131_n21.y1est
rspc015_n1.y1est
rfce09c_i8.y1est
rvin038_j19.y1est
risp10_e17.y1est
ruio30_b2.y1est
rspc009_o22.y1est
DN122833est
reje22b_a6.y1est
rcli10b_b10.y1est
AJ680339est
rcmu38_n15.y1est
DY415078est
rese26c_g5.y1est
CK462446est
DN123194est
rret03_h4.y1est
nep11c_j17.z1est
rspc003_k12.y1est
rski0127_o24.y1est
BP163822est
rute2114b_g4.y1est
DY412036est
BP164511est
CV869304est
rbyc_38580.y1reads
BW974851est
rfbs3928b_j7.y1est
DN107000est
rnco1915b_l13.y1est
BX918104est
rcki012_m5.y1est
rnco1916b_k19.y1est
ruio11_k19.y1est
BX926535est
rsto222_g17.y1est
DY437431est
rhyp11c_n24.y1est
risp04_m12.y1est
rcad22b_k19.y1est
rrec30_b17.y1est
rpldo0104_j21.y1est
AJ947384est
CV867433est
DN120156est
BW980298est
BG383462est
rmed01c_d4.y1est
rhea17_m2.y1est
DN131845est
risp07_m11.y1est
rret32_a1.y1est
rese18c_e13.y1est
rfce34c_l23.y1est
CX057564est
BW979862est
rnco1912b_d18.y1est
CN158824est
rssp27_l12.y1est
rcov40b_f6.y1est
CF367889est
DN131780est
rnlu1834b_d3.y1est
rfat0126_e10.y1est
CN154131est
AJ948424est
CB477543est
BW955776est
CK454471est
rhea39_d17.y1est
AJ651759est
rche22_j1.y1est
rcmu22_b5.y1est
rssp12_m9.y1est
CK451220est
rfat0101_k18.y1est
relu1335c_d3r1.y1est
reru30c_j12.y1est
risp14_o14.y1est
DN114055est
CK453848est
rtra13_d16r1.y1est
DN134495est
ruio14_a18.y1est
rret26_k16.y1est
rmga22_m22.y1est
DY411193est
rsag05_i13.y1est
DY417894est
CN155145est
CN160738est
CX064875est
rpldo0111_e3.y1est
AJ657693est
rpliv0106_n11.y1est
rfat0112_i9.y1est
CN164406est
DN132095est
CK454941est
ruio04_g5.y1est
CK455986est
rvin15_l9.y1est
BP459313est
rpldo0117_j18.y1est
ruio08_p23.y1est
ruio26_l2.y1est
DN126920est
rtra01_i22.r1.y1est
rnmm28c_a12.y1est
rmgp008_i13.y1est
rsme21_c24.y1est
AU059862est
CN161905est
rmgp011_c5.y1est
DY413819est
BP138338est
rpldo0105_p8.y1est
ruio23_m13.y1est
rste18_k3.y1est
rcsk02_f20.y1est
BP144853est
rcki27_k1.y1est
ruio22_b10.y1est
rjej23b_b3.y1est
rcad06b_k15.y1est
rmed33c_f10.y1est
rese16c_g14.y1est
rspl19_o9.y1est
rute2117b_g20.y1est
EST Library Info
cad3Unavailable
cbe1Cerebellum
che2Heart - RNA from China
cki2Kidney - RNA from China
cli1Liver - RNA from China
cmu4Rhinal mucous membrane - RNA from China
cst1Stomach - RNA from China
eje3Foetus 50 days, jejunum
elu1Foetus 50 days, lung
eru1Foetus 50 days, regio umbilicalis
ese2Foetus 50 days, M. semitendinosus
fat5Fatt
fbs1Unavailable
fce3Foetus 100 days, cerebellum
fhi1Unavailable
hea3Heart
hlv1Heart, left ventricle
hyp1Hypothalamus
isp5M. Infraspinatus
jej1Small intestine, jejunum
med3Mediastinum
mgm3Mammary gland - 14 days after birth
mgp3Mammary gland - 7 days pre birth
nco5Newborn 115 days, colon
nep1Newborn 115 days, epidermis
nlu2Newborn 115 days, lung
nmm1Newborn 115 days, mucosal membranes
ova2Ovary
pfco1Unavailable
pigca1Unavailable
pldo4Unavailable
pliv1Unavailable
plun1Unavailable
rec1Rectum
ret4Retina
sag1Salivary gland
ski1Skin
sme1M. Semimembranosus
spc3Spinal cord
spl1Spleen
ssp4M. Supraspinatus
ste5M. Semitendinosus
sto2Stomach
tes4Testes
tra3Trachea
uio10Unavailable
ute4Uterus
vin3M. Vastus intermedius
Clusters
Oligos
SNPs

Gene ID ENSG00000168291 (click for geneview)
Transcript ID ENST00000302746(link to ensembl)
Symbol PDHB
Localtion Chromosome:3:58388398:58394594:-1 band: 3p14.3
Description Pyruvate dehydrogenase E1 component beta subunit, mitochondrial precursor (EC 1.2.4.1) (PDHE1-B). [Source:Uniprot/SWISSPROT;Acc:P11177]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<----------------------------------------><----------------------------------------------------><---
-M--A--A--V--S--G--L--V--R--R--P--L--R--E--V--S--G--L--L--K--R--R--F--H--W--T--A--P--A--A--L--Q--V--
ATGGCGGCGGTGTCTGGCTTGGTGCGGAGACCCCTTCGGGAGGTCTCCGGGCTGCTGAAGAGGCGCTTTCACTGGACCGCGCCGGCTGCGCTGCAGGTGA
                                                                                                ::.:
------------------------------------------------------------------------------------------------GTAA
-------------------------------------------------------------------------------------------------V--

----------------------------------------------------------------------------------------------------
T--V--R--D--A--I--N--Q--G--M--D--E--E--L--E--R--D--E--K--V--F--L--L--G--E--E--V--A--Q--Y--D--G--A--Y
CAGTTCGTGATGCTATAAATCAGGGTATGGATGAGGAGCTGGAAAGAGATGAGAAGGTATTTCTGCTTGGAGAAGAAGTTGCCCAGTATGATGGGGCATA
::::::::::.:::::::::::.::::::::::::::::::::::::::::::::::::::::: :::::.:::::::::::.:::::::::::::::::
CAGTTCGTGACGCTATAAATCAAGGTATGGATGAGGAGCTGGAAAGAGATGAGAAGGTATTTCTCCTTGGGGAAGAAGTTGCTCAGTATGATGGGGCATA
T--V--R--D--A--I--N--Q--G--M--D--E--E--L--E--R--D--E--K--V--F--L--L--G--E--E--V--A--Q--Y--D--G--A--Y

---><-------------------------------------------------------------><--------------------------------
--K--V--S--R--G--L--W--K--K--Y--G--D--K--R--I--I--D--T--P--I--S--E--M--G--F--A--G--I--A--V--G--A--A-
CAAGGTTAGTCGAGGGCTGTGGAAGAAATATGGAGACAAGAGGATTATTGACACTCCCATATCAGAGATGGGCTTTGCTGGAATTGCTGTAGGTGCAGCT
.:::                                                               :::::::::::::::::::::::::::::.:::
TAAG---------------------------------------------------------------ATGGGCTTTGCTGGAATTGCTGTAGGTGCGGCT
--K-----------------------------------------------------------------M--G--F--A--G--I--A--V--G--A--A-

--><------------------------------------------------------------------------------------------------
-M--A--G--L--R--P--I--C--E--F--M--T--F--N--F--S--M--Q--A--I--D--Q--V--I--N--S--A--A--K--T--Y--Y--M--
ATGGCTGGGTTGCGGCCCATTTGTGAATTTATGACCTTCAATTTCTCCATGCAAGCCATTGACCAGGTTATAAACTCAGCTGCCAAGACCTACTACATGT
:::::::::::: ::::::::::.:::::::::::::::::::::::.::::::::::::::::::::::::::::::::::::::::::::.:::::::
ATGGCTGGGTTGAGGCCCATTTGCGAATTTATGACCTTCAATTTCTCTATGCAAGCCATTGACCAGGTTATAAACTCAGCTGCCAAGACCTATTACATGT
-M--A--G--L--R--P--I--C--E--F--M--T--F--N--F--S--M--Q--A--I--D--Q--V--I--N--S--A--A--K--T--Y--Y--M--

----------------------------------------------------------------------------------------------------
S--G--G--L--Q--P--V--P--I--V--F--R--G--P--N--G--A--S--A--G--V--A--A--Q--H--S--Q--C--F--A--A--W--Y--G
CTGGTGGCCTTCAGCCTGTGCCTATAGTCTTCAGAGGGCCCAATGGTGCCTCAGCAGGTGTAGCTGCCCAGCACTCACAGTGCTTTGCTGCCTGGTATGG
: :: :::::::::.:::::::.:::::::::::.::::::::::::::::::::::::::::: :::::::::::::::::::::::::::::::::::
CGGGGGGCCTTCAGTCTGTGCCCATAGTCTTCAGGGGGCCCAATGGTGCCTCAGCAGGTGTAGCAGCCCAGCACTCACAGTGCTTTGCTGCCTGGTATGG
S--G--G--L--Q--S--V--P--I--V--F--R--G--P--N--G--A--S--A--G--V--A--A--Q--H--S--Q--C--F--A--A--W--Y--G

----------------------------------------------------------------------------------------><----------
--H--C--P--G--L--K--V--V--S--P--W--N--S--E--D--A--K--G--L--I--K--S--A--I--R--D--N--N--P--V--V--V--L-
GCACTGCCCAGGCTTAAAGGTGGTCAGTCCCTGGAATTCAGAGGATGCTAAAGGACTTATTAAATCAGCCATTCGGGATAACAATCCAGTGGTGGTGCTA
:::::::::::::::::::::::::::.:::::::..:::::.::::: :::::::::::::::::::::::::::::::::::::::   ::::::::.
GCACTGCCCAGGCTTAAAGGTGGTCAGCCCCTGGAGCTCAGAAGATGCGAAAGGACTTATTAAATCAGCCATTCGGGATAACAATCCA---GTGGTGCTG
--H--C--P--G--L--K--V--V--S--P--W--S--S--E--D--A--K--G--L--I--K--S--A--I--R--D--N--N--P-----V--V--L-

--------------------------------------------------------------------------------------------------->
-E--N--E--L--M--Y--G--V--P--F--E--F--P--P--E--A--Q--S--K--D--F--L--I--P--I--G--K--A--K--I--E--R--Q--
GAGAATGAATTGATGTATGGGGTTCCTTTTGAATTTCCTCCGGAAGCTCAGTCAAAAGATTTTCTGATTCCTATTGGAAAAGCCAAAATAGAAAGGCAAG
:::::::::::.::::::::.::::::::::::.::::: :.::::::::::::::::::::::::::::::::::::::::::::::::::::::::: 
GAGAATGAATTAATGTATGGAGTTCCTTTTGAACTTCCTGCAGAAGCTCAGTCAAAAGATTTTCTGATTCCTATTGGAAAAGCCAAAATAGAAAGGCAA-
-E--N--E--L--M--Y--G--V--P--F--E--L--P--A--E--A--Q--S--K--D--F--L--I--P--I--G--K--A--K--I--E--R--Q--

<------------------------------------------------------------------------------------------><-------
G--T--H--I--T--V--V--S--H--S--R--P--V--G--H--C--L--E--A--A--A--V--L--S--K--E--G--V--E--C--E--V--I--N
GAACACATATAACTGTGGTTTCCCATTCAAGACCTGTGGGCCACTGCTTAGAAGCTGCAGCAGTGCTATCTAAAGAAGGAGTTGAATGTGAGGTGATAAA
  :::::.::::: .:.::::::::::::::::::::::::::::::::::::::::: .::::::::::::::::::::.:::::::::::::::::::
--ACACACATAACGATAGTTTCCCATTCAAGACCTGTGGGCCACTGCTTAGAAGCTGCCACAGTGCTATCTAAAGAAGGAATTGAATGTGAGGTGATAAA
---T--H--I--T--I--V--S--H--S--R--P--V--G--H--C--L--E--A--A--T--V--L--S--K--E--G--I--E--C--E--V--I--N

----------------------------------------------------------------------------------------------------
--M--R--T--I--R--P--M--D--M--E--T--I--E--A--S--V--M--K--T--N--H--L--V--T--V--E--G--G--W--P--Q--F--G-
TATGCGTACCATTAGACCAATGGACATGGAAACCATAGAAGCCAGTGTCATGAAGACAAATCATCTTGTAACTGTGGAAGGAGGCTGGCCACAGTTTGGA
:::::: :::::.:::::::::::::: ::::: ::::::::::::::::::::::: : ::::::..::::::::::::::::::::::::::::::::
TATGCGAACCATCAGACCAATGGACATTGAAACAATAGAAGCCAGTGTCATGAAGACCACTCATCTCATAACTGTGGAAGGAGGCTGGCCACAGTTTGGA
--M--R--T--I--R--P--M--D--I--E--T--I--E--A--S--V--M--K--T--T--H--L--I--T--V--E--G--G--W--P--Q--F--G-

---------------------------------><-----------------------------------------------------------------
-V--G--A--E--I--C--A--R--I--M--E--G--P--A--F--N--F--L--D--A--P--A--V--R--V--T--G--A--D--V--P--M--P--
GTAGGAGCTGAAATCTGTGCCAGGATCATGGAAGGTCCTGCGTTCAATTTCCTGGATGCTCCTGCTGTTCGTGTCACTGGTGCTGATGTCCCTATGCCTT
.:::::::::::::.::::::::::::::::::   ::.::.::::::::::::::::::::::: ::::: :::::::::::::::::.::::::::::
ATAGGAGCTGAAATTTGTGCCAGGATCATGGAA---CCCGCATTCAATTTCCTGGATGCTCCTGCAGTTCGAGTCACTGGTGCTGATGTTCCTATGCCTT
-I--G--A--E--I--C--A--R--I--M--E-----P--A--F--N--F--L--D--A--P--A--V--R--V--T--G--A--D--V--P--M--P--

------------------------------------------------------------------------------->
Y--A--K--I--L--E--D--N--S--I--P--Q--V--K--D--I--I--F--A--I--K--K--T--L--N--I--*-
ATGCAAAGATTCTAGAGGACAACTCTATACCTCAGGTCAAAGACATCATATTTGCAATAAAGAAAACATTAAATATTTAG
:::::::::::::.::.:::::::::.::::::::::.::::::::::: ::::::::::::::::::.:::::::.:::
ATGCAAAGATTCTGGAAGACAACTCTGTACCTCAGGTTAAAGACATCATTTTTGCAATAAAGAAAACACTAAATATCTAG
Y--A--K--I--L--E--D--N--S--V--P--Q--V--K--D--I--I--F--A--I--K--K--T--L--N--I--*-

Pig Consensus Sequence

>BGISUST0000894695
------------------------------------------------------------------------------------------------GTAA
CAGTTCGTGACGCTATAAATCAAGGTATGGATGAGGAGCTGGAAAGAGATGAGAAGGTATTTCTCCTTGGGGAAGAAGTTGCTCAGTATGATGGGGCATA
TAAG---------------------------------------------------------------ATGGGCTTTGCTGGAATTGCTGTAGGTGCGGCT
ATGGCTGGGTTGAGGCCCATTTGCGAATTTATGACCTTCAATTTCTCTATGCAAGCCATTGACCAGGTTATAAACTCAGCTGCCAAGACCTATTACATGT
CGGGGGGCCTTCAGTCTGTGCCCATAGTCTTCAGGGGGCCCAATGGTGCCTCAGCAGGTGTAGCAGCCCAGCACTCACAGTGCTTTGCTGCCTGGTATGG
GCACTGCCCAGGCTTAAAGGTGGTCAGCCCCTGGAGCTCAGAAGATGCGAAAGGACTTATTAAATCAGCCATTCGGGATAACAATCCA---GTGGTGCTG
GAGAATGAATTAATGTATGGAGTTCCTTTTGAACTTCCTGCAGAAGCTCAGTCAAAAGATTTTCTGATTCCTATTGGAAAAGCCAAAATAGAAAGGCAA-
--ACACACATAACGATAGTTTCCCATTCAAGACCTGTGGGCCACTGCTTAGAAGCTGCCACAGTGCTATCTAAAGAAGGAATTGAATGTGAGGTGATAAA
TATGCGAACCATCAGACCAATGGACATTGAAACAATAGAAGCCAGTGTCATGAAGACCACTCATCTCATAACTGTGGAAGGAGGCTGGCCACAGTTTGGA
ATAGGAGCTGAAATTTGTGCCAGGATCATGGAA---CCCGCATTCAATTTCCTGGATGCTCCTGCAGTTCGAGTCACTGGTGCTGATGTTCCTATGCCTT
ATGCAAAGATTCTGGAAGACAACTCTGTACCTCAGGTTAAAGACATCATTTTTGCAATAAAGAAAACACTAAATATCTAG


>BGISUSP0000894695
--------------------------------VTVRDAINQGMDEELERDEKVFLLGEEVAQYDGAYK---------------------MGFAGIAVGAA
MAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSGGLQSVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWSSEDAKGLIKSAIRDNNP-VVL
ENELMYGVPFELPAEAQSKDFLIPIGKAKIERQ-THITIVSHSRPVGHCLEAATVLSKEGIECEVINMRTIRPMDIETIEASVMKTTHLITVEGGWPQFG
IGAEICARIME-PAFNFLDAPAVRVTGADVPMPYAKILEDNSVPQVKDIIFAIKKTLNI*