Sequences
EST Library Info
cbl2Blood
ese2Foetus 50 days, M. semitendinosus
nep2Newborn 115 days, epidermis
ton1Tip of tongue, mucosal membrane
Clusters
Oligos
SNPs

Gene ID ENSG00000168297 (click for geneview)
Transcript ID ENST00000302779(link to ensembl)
Symbol PXK
Localtion Chromosome:3:58293657:58385918:1 band: 3p14.3
Description PX domain containing serine/threonine kinase [Source:RefSeq_peptide;Acc:NP_060241]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<---------------------------------------------------------------------------------------------------
-M--A--F--M--E--K--P--P--A--G--K--V--L--L--D--D--T--V--P--L--T--A--A--I--E--A--S--Q--S--L--Q--S--H--
ATGGCCTTCATGGAGAAGCCGCCAGCCGGCAAGGTGCTGCTGGACGACACGGTGCCGCTGACAGCAGCCATCGAGGCGAGCCAGAGCCTGCAGTCCCACA
:::::::::::::::::::::::.:::::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::
ATGGCCTTCATGGAGAAGCCGCCGGCCGGCAAGGTGCTGCTGGACGACACGGTGCCGCTGACAGCAGCCATTGAGGCGAGCCAGAGCCTGCAGTCCCACA
-M--A--F--M--E--K--P--P--A--G--K--V--L--L--D--D--T--V--P--L--T--A--A--I--E--A--S--Q--S--L--Q--S--H--

-><-------------------------------------------------><----------------------------------------------
T--E--Y--I--I--R--V--Q--R--G--I--S--V--E--N--S--W--Q--I--V--R--R--Y--S--D--F--D--L--L--N--N--S--L--Q
CGGAATATATTATTCGAGTGCAAAGAGGAATTTCTGTGGAAAACAGCTGGCAGATTGTTAGAAGATACAGTGACTTTGATTTGCTTAACAACAGCTTACA
::::::::::.:::::.::::::::::::::::::::.:::::.:::::::::::::::::.::::::::::::::::::::::: :::::::::::.::
CGGAATATATCATTCGGGTGCAAAGAGGAATTTCTGTAGAAAATAGCTGGCAGATTGTTAGGAGATACAGTGACTTTGATTTGCTGAACAACAGCTTGCA
T--E--Y--I--I--R--V--Q--R--G--I--S--V--E--N--S--W--Q--I--V--R--R--Y--S--D--F--D--L--L--N--N--S--L--Q

><--------------------------------------------------------------------------------------------------
--I--A--G--L--S--L--P--L--P--P--K--K--L--I--G--N--M--D--R--E--F--I--A--E--R--Q--K--G--L--Q--N--Y--L-
GATTGCAGGCCTAAGTCTACCTCTTCCTCCCAAAAAATTGATTGGTAACATGGATCGTGAATTCATAGCTGAAAGGCAGAAAGGTCTTCAGAACTATCTC
::::.:::::::::::::::::::::::::::::::::::::::::::::::::::: ::::::::::::::.:::::::::::::::::::::::::::
GATTACAGGCCTAAGTCTACCTCTTCCTCCCAAAAAATTGATTGGTAACATGGATCGGGAATTCATAGCTGAGAGGCAGAAAGGTCTTCAGAACTATCTC
--I--T--G--L--S--L--P--L--P--P--K--K--L--I--G--N--M--D--R--E--F--I--A--E--R--Q--K--G--L--Q--N--Y--L-

---------------------------------------------------------------------------------------><-----------
-N--V--I--T--T--N--H--I--L--S--N--C--E--L--V--K--K--F--L--D--P--N--N--Y--S--A--N--Y--T--E--I--A--L--
AACGTGATCACAACAAATCATATCTTGTCTAATTGTGAGCTGGTTAAGAAGTTTTTAGATCCAAACAACTATTCCGCAAACTATACTGAGATTGCCTTGC
::::: ::::: :: ::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::.::::::::.:::   ::::::::.:
AACGTTATCACCACCAATCATATCTTGTCTAATTGTGAGCTGGTTAAGAAGTTTTTAGACCCAAACAACTATTCTGCAAACTACACT---ATTGCCTTAC
-N--V--I--T--T--N--H--I--L--S--N--C--E--L--V--K--K--F--L--D--P--N--N--Y--S--A--N--Y--T-----I--A--L--

-----------------------------------------------------------------><---------------------------------
Q--Q--V--S--M--F--F--R--S--E--P--K--W--E--V--V--E--P--L--K--D--I--G--W--R--I--R--K--K--Y--F--L--M--K
AACAGGTTTCCATGTTCTTCCGATCAGAACCAAAGTGGGAGGTGGTGGAACCTTTGAAAGACATAGGTTGGAGAATAAGGAAGAAATATTTCTTGATGAA
:.:::::::::::::::::: :::::::::::::::::::::::::.::::: :::::::::      ::::::::::::::::::::::::::::::::
AGCAGGTTTCCATGTTCTTCAGATCAGAACCAAAGTGGGAGGTGGTAGAACCATTGAAAGAC------TGGAGAATAAGGAAGAAATATTTCTTGATGAA
Q--Q--V--S--M--F--F--R--S--E--P--K--W--E--V--V--E--P--L--K--D--------W--R--I--R--K--K--Y--F--L--M--K

---------------------------------------><-----------------------------------------------------------
--I--K--N--Q--P--K--E--R--L--V--L--S--W--A--D--L--G--P--D--K--Y--L--S--D--K--D--F--Q--C--L--I--K--L-
GATTAAAAATCAGCCAAAGGAACGGCTAGTGTTAAGCTGGGCTGACCTTGGCCCAGACAAGTATTTGTCAGATAAAGATTTTCAGTGTCTAATCAAACTT
:::::::::::::::::::::::::::::::::::::::::::::::::::.:: :::::::::.:::::::::::::::::::::::::::::::.:::
GATTAAAAATCAGCCAAAGGAACGGCTAGTGTTAAGCTGGGCTGACCTTGGTCCTGACAAGTATCTGTCAGATAAAGATTTTCAGTGTCTAATCAAGCTT
--I--K--N--Q--P--K--E--R--L--V--L--S--W--A--D--L--G--P--D--K--Y--L--S--D--K--D--F--Q--C--L--I--K--L-

--------------><------------------------------------------------------------------------------------
-L--P--S--C--L--H--P--Y--I--Y--R--V--T--F--A--T--A--N--E--S--S--A--L--L--I--R--M--F--N--E--K--G--T--
CTGCCTTCTTGTTTGCACCCTTACATCTATCGGGTTACCTTTGCCACAGCTAATGAATCCTCAGCGTTGCTAATTAGGATGTTTAACGAAAAGGGAACAT
::::::::.::::::::.:::::::::: ::: ::::::::::::::::::::.::::::::.::.:::.::::::::::::::::.:::::.::::: :
CTGCCTTCCTGTTTGCATCCTTACATCTTTCGTGTTACCTTTGCCACAGCTAACGAATCCTCGGCATTGTTAATTAGGATGTTTAATGAAAAAGGAACTT
-L--P--S--C--L--H--P--Y--I--F--R--V--T--F--A--T--A--N--E--S--S--A--L--L--I--R--M--F--N--E--K--G--T--

-------------------><-------------------------------------------------------------------------------
L--K--D--L--I--Y--K--A--K--P--K--D--P--F--L--K--K--Y--C--N--P--K--K--I--Q--G--L--E--L--Q--Q--I--K--T
TGAAGGATCTGATCTACAAGGCAAAACCAAAAGACCCATTTCTAAAGAAGTACTGCAACCCTAAGAAGATTCAGGGCCTGGAACTCCAGCAAATAAAAAC
:::::::.::::::::::::::::::::::::::::::::.::::.:::::::::.:::::::::::::::::.::::: ::::::::::::::::::::
TGAAGGACCTGATCTACAAGGCAAAACCAAAAGACCCATTCCTAAGGAAGTACTGTAACCCTAAGAAGATTCAAGGCCTTGAACTCCAGCAAATAAAAAC
L--K--D--L--I--Y--K--A--K--P--K--D--P--F--L--R--K--Y--C--N--P--K--K--I--Q--G--L--E--L--Q--Q--I--K--T

---------------------><-----------------------------------------------------------------------------
--Y--G--R--Q--I--L--E--V--L--K--F--L--H--D--K--G--F--P--Y--G--H--L--H--A--S--N--V--M--L--D--G--D--T-
ATATGGACGGCAAATATTAGAGGTACTGAAGTTTCTTCATGACAAGGGATTCCCTTATGGGCATCTTCACGCCTCCAATGTGATGCTCGATGGGGACACT
::::::.::::::::::::::::::::.::::::::.::::::::.::.::::::::::::::::::::.::::::::::::.:::: :: ::.::::::
ATATGGGCGGCAAATATTAGAGGTACTAAAGTTTCTCCATGACAAAGGGTTCCCTTATGGGCATCTTCATGCCTCCAATGTGGTGCTAGAAGGAGACACT
--Y--G--R--Q--I--L--E--V--L--K--F--L--H--D--K--G--F--P--Y--G--H--L--H--A--S--N--V--V--L--E--G--D--T-

-----------------------------------------------------------------------------------><---------------
-C--R--L--L--D--L--E--N--S--L--L--G--L--P--S--F--Y--R--S--Y--F--S--Q--F--R--K--I--N--T--L--E--S--V--
TGCCGGCTGCTGGACCTTGAGAATTCCTTATTGGGCCTGCCTTCCTTCTACCGATCTTATTTTTCACAATTCAGGAAAATCAATACATTGGAAAGTGTGG
:::::::::::.:::::::::::::::::.:::::::: :::::::::::::::::.:::::.::::::::::::::::::::::::.::::.:::::::
TGCCGGCTGCTAGACCTTGAGAATTCCTTGTTGGGCCTCCCTTCCTTCTACCGATCCTATTTCTCACAATTCAGGAAAATCAATACACTGGAGAGTGTGG
-C--R--L--L--D--L--E--N--S--L--L--G--L--P--S--F--Y--R--S--Y--F--S--Q--F--R--K--I--N--T--L--E--S--V--

----------------------------------------------------------------------------------------------------
D--V--H-----C--F--G-----H--L--L--Y--E--M--T--Y--G--R--P--P--D--S--V--P--V--D-----S--F--P--P--A--P--S
ATGTCCAC---TGCTTTGGC---CACTTACTGTATGAAATGACTTATGGACGACCGCCAGACTCGGTGCCTGTGGAC---TCCTTCCCTCCTGCCCCGTC
:.:::. :    .:::.::    :::::::::::::::::::::::.::::::::::::::::::::::::::.:::   :::::::: ::::: :::::
ACGTCTTCT--GACTTCGGGC--CACTTACTGTATGAAATGACTTACGGACGACCGCCAGACTCGGTGCCTGTAGACT--TCCTTCCCGCCTGCACCGTC
D--V--F--\--C--F--G--\--H--L--L--Y--E--M--T--Y--G--R--P--P--D--S--V--P--V--D--\--S--F--P--P--A--P--S

----------><-----------------------------------------------------------------------------><---------
--M--A--V--V--A--V--L--E--S--T--L--S--C--E--A--C--K--N--G--M--P--T--I--S--R--L--L--Q--M--P--L--F--S-
CATGGCTGTGGTGGCCGTGTTGGAGTCTACGCTGTCTTGTGAAGCCTGTAAAAATGGCATGCCTACCATCTCCCGGCTCTTACAGATGCCATTATTCAGC
.:::::::::            :::::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::   ::::::::.
TATGGCTGTG------------GAGTCTACGCTGTCTTGTGAAGCCTGTAAAAATGGCATGCCTACCGTCTCCCGGCTCTTACAGATG---TTATTCAGT
--M--A--V--------------E--S--T--L--S--C--E--A--C--K--N--G--M--P--T--V--S--R--L--L--Q--M-----L--F--S-

--------------------------------------><------------------------------------------------------------
-D--V--L--L--T--T--S--E--K--P--Q--F--K--I--P--T--K--L--K--E--A--L--R--I--A--K--E--C--I--E--K--R--L--
GATGTTTTACTAACCACTTCTGAAAAACCACAGTTTAAGATCCCTACAAAGTTAAAAGAGGCATTGAGAATTGCCAAAGAATGTATAGAGAAGAGACTAA
::::::.:.:::::::::::::::::.:::::::::::::::::.:::::::::::::::::::::::::::::::::::.::::::::.::::::::::
GATGTTCTGCTAACCACTTCTGAAAAGCCACAGTTTAAGATCCCCACAAAGTTAAAAGAGGCATTGAGAATTGCCAAAGAGTGTATAGAAAAGAGACTAA
-D--V--L--L--T--T--S--E--K--P--Q--F--K--I--P--T--K--L--K--E--A--L--R--I--A--K--E--C--I--E--K--R--L--

----------------><----------------------------------------------------------------------------------
I--E--E--Q--K--Q--I--H--Q--H--R--R--L--T--R--A--Q--S--H--H--G--S--E--E--E--R--K--K--R--K--I--L--A--R
TTGAGGAACAGAAACAGATTCACCAGCATCGAAGACTGACAAGAGCTCAGTCCCACCATGGATCTGAGGAGGAAAGAAAAAAAAGAAAGATTTTAGCTCG
:.::.::::::::::::::.::::::::.::.::::::::::::::::::::.:::::.::::::::.::.:::::::::::.::.::::::::::::::
TCGAAGAACAGAAACAGATCCACCAGCACCGGAGACTGACAAGAGCTCAGTCTCACCACGGATCTGAAGAAGAAAGAAAAAAGAGGAAGATTTTAGCTCG
I--E--E--Q--K--Q--I--H--Q--H--R--R--L--T--R--A--Q--S--H--H--G--S--E--E--E--R--K--K--R--K--I--L--A--R

---><--------------------------------------------------------------------><-------------------------
--K--K--S--K--R--S--A--L--E--N--S--E--E--H--S--A--K--Y--S--N--S--N--N--S--A--G--S--G--A--S--S--P--L-
AAAGAAGTCAAAACGATCTGCTCTTGAAAATAGTGAAGAGCATTCAGCGAAGTACAGCAACTCCAATAATTCAGCAGGATCTGGGGCCAGCTCACCTCTC
:::::::::::::::::::::  ::::::::::::::::.::::::::.::.:::::::::::::::::::::   :::::::::::::::::::::::.
AAAGAAGTCAAAACGATCTGCAGTTGAAAATAGTGAAGAACATTCAGCAAAATACAGCAACTCCAATAATTCA---GGATCTGGGGCCAGCTCACCTCTT
--K--K--S--K--R--S--A--V--E--N--S--E--E--H--S--A--K--Y--S--N--S--N--N--S-----G--S--G--A--S--S--P--L-

------------------------------------><--------------------------------------------------------------
-T--S--P--S--S--P--T--P--P--S--T--S--G--I--S--A--L--P--P--P--P--P--P--P--P--P--P--A--A--P--L--P--P--
ACGTCCCCGTCATCGCCAACTCCACCCTCTACATCAGGGATATCTGCATTACCTCCACCTCCTCCACCTCCACCACCACCAGCAGCTCCCTTGCCTCCTG
::.::::::::::::::::: :::::::::::: ::   ::.::.::::::   :: :: ::::: :: :: ::::::::::::::::::::::::::::
ACATCCCCGTCATCGCCAACACCACCCTCTACAGCA---ATGTCCGCATTA---CCTCCACCTCCTCCACCTCCACCACCAGCAGCTCCCTTGCCTCCTG
-T--S--P--S--S--P--T--P--P--S--T--A-----M--S--A--L-----P--P--P--P--P--P--P--P--P--A--A--P--L--P--P--

----------------------------------------------------------------------------------------------------
A--S--T--E--A--P--A--Q--L--S--S--Q--A--V--N--G--M--S--R--G--A--L--L--S--S--I--Q--N--F--Q--K--G--T--L
CGAGCACCGAGGCACCTGCCCAGCTCTCGTCTCAGGCTGTGAATGGCATGAGCCGAGGGGCCTTGCTCAGCTCCATCCAGAATTTCCAAAAAGGAACTTT
:::::.:.::::: ::..: :..::..::.:::::::::::::::::.::.:::::::::::::.::::::::.::::::::::::::::::::::::::
CGAGCGCTGAGGCTCCCACACGACTTCCGCCTCAGGCTGTGAATGGCGTGGGCCGAGGGGCCTTACTCAGCTCTATCCAGAATTTCCAAAAAGGAACTTT
A--S--A--E--A--P--T--R--L--P--P--Q--A--V--N--G--V--G--R--G--A--L--L--S--S--I--Q--N--F--Q--K--G--T--L

------><-------------------------------------------------------------------------------------><-----
--R--K--K--P--V--I--T--V--L--R--R--S--A--E--A--S--C--L--H--L--E--G--K--V--L--F--Y--S--Y--S--P--P--P-
GAGGAAAAAACCTGTGATCACAGTGCTCCGAAGATCGGCTGAAGCTTCCTGTTTACACTTGGAGGGAAAAGTTCTTTTTTATTCCTACTCACCCCCCCCA
:::::::::::::::::::::::.:: :: ::::::::::.::.::::.::::::::::::::::::::::::::::::: :            ::::.:
GAGGAAAAAACCTGTGATCACAGCGCGCCTAAGATCGGCTAAAACTTCTTGTTTACACTTGGAGGGAAAAGTTCTTTTTTTT------------CCCCTA
--R--K--K--P--V--I--T--A--R--L--R--S--A--K--T--S--C--L--H--L--E--G--K--V--L--F--F--------------P--L-

----------------------------------------------------------------------------------------------------
-N--Y--P--L--P--G--K--V--I--A--E--P--V--Q--P-----Q--T--V--L--F--C--R--C--S--C--K--Q--L--F--E--R--N--
AACTACCCTCTTCCTGGGAAAGTAATTGCTGAGCCAGTACAGCCA---CAAACAGTACTATTTTGCAGATGCTCATGTAAGCAGCTTTTCGAGAGAAAT-
:: :::::::::.::::. .:.:::::::::::::::::::::::     :  :      :: :::::::::::::::::: .:::::::.:::...:  
AAGTACCCTCTTTCTGGATGAATAATTGCTGAGCCAGTACAGCCAC--ATATGA------TTGTGCAGATGCTCATGTAAGGGGCTTTTCAAGAAGGAAG
-K--Y--P--L--S--G--*--I--I--A--E--P--V--Q--P--\--Q--*--------L--C--R--C--S--C--K--G--L--F--K--K--E--

---------------------------------->
---N--S--L--S--R--I--K--L--G--W--H-
--AATTCTTTAAGCAGAATAAAGTTAGGCTGGCAT
   ::::::.:::.::::::::::..::::::   
--TATTCTTCAAGTAGAATAAAGTCGGGCTGG---
\--D--S--S--S--R--I--K--S--G--W----

Pig Consensus Sequence

>BGISUST0000889233
ATGGCCTTCATGGAGAAGCCGCCGGCCGGCAAGGTGCTGCTGGACGACACGGTGCCGCTGACAGCAGCCATTGAGGCGAGCCAGAGCCTGCAGTCCCACA
CGGAATATATCATTCGGGTGCAAAGAGGAATTTCTGTAGAAAATAGCTGGCAGATTGTTAGGAGATACAGTGACTTTGATTTGCTGAACAACAGCTTGCA
GATTACAGGCCTAAGTCTACCTCTTCCTCCCAAAAAATTGATTGGTAACATGGATCGGGAATTCATAGCTGAGAGGCAGAAAGGTCTTCAGAACTATCTC
AACGTTATCACCACCAATCATATCTTGTCTAATTGTGAGCTGGTTAAGAAGTTTTTAGACCCAAACAACTATTCTGCAAACTACACT---ATTGCCTTAC
AGCAGGTTTCCATGTTCTTCAGATCAGAACCAAAGTGGGAGGTGGTAGAACCATTGAAAGAC------TGGAGAATAAGGAAGAAATATTTCTTGATGAA
GATTAAAAATCAGCCAAAGGAACGGCTAGTGTTAAGCTGGGCTGACCTTGGTCCTGACAAGTATCTGTCAGATAAAGATTTTCAGTGTCTAATCAAGCTT
CTGCCTTCCTGTTTGCATCCTTACATCTTTCGTGTTACCTTTGCCACAGCTAACGAATCCTCGGCATTGTTAATTAGGATGTTTAATGAAAAAGGAACTT
TGAAGGACCTGATCTACAAGGCAAAACCAAAAGACCCATTCCTAAGGAAGTACTGTAACCCTAAGAAGATTCAAGGCCTTGAACTCCAGCAAATAAAAAC
ATATGGGCGGCAAATATTAGAGGTACTAAAGTTTCTCCATGACAAAGGGTTCCCTTATGGGCATCTTCATGCCTCCAATGTGGTGCTAGAAGGAGACACT
TGCCGGCTGCTAGACCTTGAGAATTCCTTGTTGGGCCTCCCTTCCTTCTACCGATCCTATTTCTCACAATTCAGGAAAATCAATACACTGGAGAGTGTGG
ACGTCTTcgACTTCGGgcACTTACTGTATGAAATGACTTACGGACGACCGCCAGACTCGGTGCCTGTAGActCCTTCCCGCCTGCACCGTCTATGGCTGT
G------------GAGTCTACGCTGTCTTGTGAAGCCTGTAAAAATGGCATGCCTACCGTCTCCCGGCTCTTACAGATG---TTATTCAGTGATGTTCTG
CTAACCACTTCTGAAAAGCCACAGTTTAAGATCCCCACAAAGTTAAAAGAGGCATTGAGAATTGCCAAAGAGTGTATAGAAAAGAGACTAATCGAAGAAC
AGAAACAGATCCACCAGCACCGGAGACTGACAAGAGCTCAGTCTCACCACGGATCTGAAGAAGAAAGAAAAAAGAGGAAGATTTTAGCTCGAAAGAAGTC
AAAACGATCTGCAGTTGAAAATAGTGAAGAACATTCAGCAAAATACAGCAACTCCAATAATTCA---GGATCTGGGGCCAGCTCACCTCTTACATCCCCG
TCATCGCCAACACCACCCTCTACAGCA---ATGTCCGCATTACCTCCACCTCCTCCACCTCCACCACCAGCAGCTCCCTTGCCTCCTGCGAGCGCTGAGG
CTCCCACACGACTTCCGCCTCAGGCTGTGAATGGCGTGGGCCGAGGGGCCTTACTCAGCTCTATCCAGAATTTCCAAAAAGGAACTTTGAGGAAAAAACC
TGTGATCACAGCGCGCCTAAGATCGGCTAAAACTTCTTGTTTACACTTGGAGGGAAAAGTTCTTTTTTTT------------CCCCTAAAGTACCCTCTT
TCTGGATGAATAATTGCTGAGCCAGTACAGCCaaTATGATTGTGCAGATGCTCATGTAAGGGGCTTTTCAAGAAGGAatATTCTTCAAGTAGAATAAAGT
CGGGCTGG---


>BGISUSP0000889233
MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQITGLSLPLPPKKLIGNMDREFIAERQKGLQNYL
NVITTNHILSNCELVKKFLDPNNYSANYT-IALQQVSMFFRSEPKWEVVEPLKD--WRIRKKYFLMKIKNQPKERLVLSWADLGPDKYLSDKDFQCLIKL
LPSCLHPYIFRVTFATANESSALLIRMFNEKGTLKDLIYKAKPKDPFLRKYCNPKKIQGLELQQIKTYGRQILEVLKFLHDKGFPYGHLHASNVVLEGDT
CRLLDLENSLLGLPSFYRSYFSQFRKINTLESVDVFDFGHLLYEMTYGRPPDSVPVDSFPPAPSMAV----ESTLSCEACKNGMPTVSRLLQM-LFSDVL
LTTSEKPQFKIPTKLKEALRIAKECIEKRLIEEQKQIHQHRRLTRAQSHHGSEEERKKRKILARKKSKRSAVENSEEHSAKYSNSNNS-GSGASSPLTSP
SSPTPPSTA-MSALPPPPPPPPPAAPLPPASAEAPTRLPPQAVNGVGRGALLSSIQNFQKGTLRKKPVITARLRSAKTSCLHLEGKVLFF----PLKYPL
SG*IIAEPVQPI*LCRCSCKGLFKKEYSSSRIKSGW-