Sequences
EST Library Info
pigcb4Unavailable
ret1Retina
Clusters
Oligos
SNPs

Gene ID ENSG00000169299 (click for geneview)
Transcript ID ENST00000302826(link to ensembl)
Symbol PGM2
Localtion Chromosome:4:37650909:37686275:1 band: 4p14
Description phosphoglucomutase 2 [Source:RefSeq_peptide;Acc:NP_060760]
Phylogenetic trees Goto TreeFam
Found Homolog YES

Show assembled from
↑ Human UTR Coding Intron   Pig Cluster reads Sequence EST Sequence Oligo  
↓Quality Color Table
not available >=0 - <20 >=20 - <40 >=40 - <60 >=60 - <80 >=80 - <100
<-------------------------------------------------------------------------------><------------------
-M--A--A--P--E--G--S--G--L--G--E--D--A--R--L--D--Q--E--T--A--Q--W--L--R--W--D--K--N--S--L--T--L--E--
ATGGCGGCTCCAGAAGGCAGCGGTCTAGGCGAGGACGCCCGGCTGGACCAGGAGACCGCCCAGTGGCTGCGCTGGGACAAGAATTCCTTAACTTTGGAGG
   :::.::::.:.:.::.::::.:. .::: :::::::::::::::::::::::: .:::.::::::::: ::::::::::::.:.::::::: :::: 
---GCGACTCCGGGAAGCGGCGGCCCCAGCGTGGACGCCCGGCTGGACCAGGAGACGACCCGGTGGCTGCGATGGGACAAGAATCCTTTAACTTGGGAGT
----A--T--P--G--S--G--G--P--S--V--D--A--R--L--D--Q--E--T--T--R--W--L--R--W--D--K--N--P--L--T--W--E--

----------------------------------------------------------------------------------------------------
A--V--K--R--L--I--A--E--G--N--K--E--E--L--R--K--C--F--G--A--R--M--E--F--G--T--A--G--L--R--A--A--M--G
CAGTGAAACGACTAATAGCAGAAGGTAATAAAGAAGAACTACGAAAATGTTTTGGGGCCCGAATGGAGTTTGGGACAGCTGGCCTCCGAGCTGCTATGGG
:::::::::::::: : : :::::.:::::::::::::::.:..::::::::::::::.:::::::::::.:::::::::::.:::::::::.. :::::
CAGTGAAACGACTACTTGAAGAAGATAATAAAGAAGAACTGCAGAAATGTTTTGGGGCTCGAATGGAGTTCGGGACAGCTGGTCTCCGAGCTATGATGGG
S--V--K--R--L--L--E--E--D--N--K--E--E--L--Q--K--C--F--G--A--R--M--E--F--G--T--A--G--L--R--A--M--M--G

------------------------------------------------><--------------------------------------------------
--P--G--I--S--R--M--N--D--L--T--I--I--Q--T--T--Q--G--F--C--R--Y--L--E--K--Q--F--S--D--L--K--Q--K--G-
ACCTGGAATTTCTCGTATGAATGACTTGACCATCATCCAGACTACACAGGGATTTTGCAGATACCTGGAAAAACAATTCAGTGACTTAAAGCAGAAAGGC
: : :::::.::::::::::::::::::::::::::::::::::::::::::.::::::::::::::::::::::::::::::::.: :::::.:.:::.
AGCAGGAATCTCTCGTATGAATGACTTGACCATCATCCAGACTACACAGGGACTTTGCAGATACCTGGAAAAACAATTCAGTGACCTCAAGCAAAGAGGT
--A--G--I--S--R--M--N--D--L--T--I--I--Q--T--T--Q--G--L--C--R--Y--L--E--K--Q--F--S--D--L--K--Q--R--G-

-------------------------------------------------------><-------------------------------------------
-I--V--I--S--F--D--A--R--A--H--P--S--S--G--G--S--S--R--R--F--A--R--L--A--A--T--T--F--I--S--Q--G--I--
ATCGTGATCAGTTTTGACGCCCGAGCTCATCCATCCAGTGGGGGTAGCAGCAGAAGGTTTGCCCGACTTGCTGCAACCACATTTATCAGTCAGGGGATTC
.:.::::::::.:::::.::.:::::.::: :: : :::::.::.:::::::::   ::::::::.::::::::::::.:.::::::::.::::::::::
GTTGTGATCAGCTTTGATGCTCGAGCCCATACAGCAAGTGGAGGCAGCAGCAGA---TTTGCCCGGCTTGCTGCAACCGCGTTTATCAGCCAGGGGATTC
-V--V--I--S--F--D--A--R--A--H--T--A--S--G--G--S--S--R-----F--A--R--L--A--A--T--A--F--I--S--Q--G--I--

----------------------------------------><----------------------------------------------------------
P--V--Y--L--F--S--D--I--T--P--T--P--F--V--P--F--T--V--S--H--L--K--L--C--A--G--I--M--I--T--A--S--H--N
CTGTGTACCTCTTTTCTGATATAACGCCAACCCCCTTTGTGCCCTTCACAGTATCACATTTGAAACTTTGTGCTGGAATCATGATAACTGCATCTCACAA
:.::::::::::::::::::::::: ::.:::::::::::::::: ::::::::::::.:::::::::::::::::::::::::::::::: ::::::::
CCGTGTACCTCTTTTCTGATATAACCCCGACCCCCTTTGTGCCCTACACAGTATCACACTTGAAACTTTGTGCTGGAATCATGATAACTGCCTCTCACAA
P--V--Y--L--F--S--D--I--T--P--T--P--F--V--P--Y--T--V--S--H--L--K--L--C--A--G--I--M--I--T--A--S--H--N

------------------------><--------------------------------------------------------------------------
--P--K--Q--D--N--G--Y--K--V--Y--W--D--N--G--A--Q--I--I--S--P--H--D--K--G--I--S--Q--A--I--E--E--N--L-
TCCAAAGCAGGATAATGGTTATAAGGTCTATTGGGATAATGGAGCTCAGATCATTTCTCCTCACGATAAAGGGATTTCTCAAGCTATTGAAGAAAATCTA
.::::::::::::::::::::.::::::::.::::::::.::.:::::::::::.::::::::.:::::::::::: :.::.::::::::::::::.:::
CCCAAAGCAGGATAATGGTTACAAGGTCTACTGGGATAACGGGGCTCAGATCATCTCTCCTCATGATAAAGGGATTGCCCAGGCTATTGAAGAAAACCTA
--P--K--Q--D--N--G--Y--K--V--Y--W--D--N--G--A--Q--I--I--S--P--H--D--K--G--I--A--Q--A--I--E--E--N--L-

----------------------------------------------------------------------------------------------------
-E--P--W--P--Q--A--W--D--D--S--L--I--D--S--S--P--L--L--H--N--P--S--A--S--I--N--N--D--Y--F--E--D--L--
GAACCGTGGCCTCAAGCTTGGGACGATTCTTTAATTGATAGCAGTCCACTTCTCCACAATCCGAGTGCTTCCATCAATAATGACTACTTTGAAGACCTTA
::.::.::::::::.:: ::::: :::::: ::::..::..:::::: ::.::.::..:.::.::::::::::::::::: :::::::::::::::::::
GAGCCATGGCCTCAGGCGTGGGAAGATTCTATAATCAATGACAGTCCCCTCCTTCATGACCCAAGTGCTTCCATCAATAAGGACTACTTTGAAGACCTTA
-E--P--W--P--Q--A--W--E--D--S--I--I--N--D--S--P--L--L--H--D--P--S--A--S--I--N--K--D--Y--F--E--D--L--

------------------><--------------------------------------------------------------------------------
K--K--Y--C--F--H--R--S--V--N--R--E--T--K--V--K--F--V--H--T--S--V--H--G--V--G--H--S--F--V--Q--S--A--F
AAAAGTACTGTTTCCACAGGAGCGTGAACAGGGAGACAAAGGTGAAGTTTGTGCACACCTCTGTCCATGGGGTGGGTCATAGCTTTGTGCAGTCAGCTTT
::::.::::::::.:::    ..::::::::::::::  :::::::::::::::::::::: :::::.:: :::: .::. .:::.::::::::.:: ::
AAAAATACTGTTTTCAC---CATGTGAACAGGGAGACCCAGGTGAAGTTTGTGCACACCTCAGTCCACGGTGTGGCCCACCACTTCGTGCAGTCGGCGTT
K--K--Y--C--F--H-----H--V--N--R--E--T--Q--V--K--F--V--H--T--S--V--H--G--V--A--H--H--F--V--Q--S--A--F

----------------------------------------------------------------------------------------------------
--K--A--F--D--L--V--P--P--E--A--V--P--E--Q--K--D--P--D--P--E--F--P--T--V--K--Y--P--N--P--E--E--G--K-
CAAGGCTTTTGACCTTGTTCCTCCTGAGGCTGTTCCTGAACAGAAAGATCCGGATCCTGAGTTTCCAACAGTGAAATACCCGAATCCCGAAGAGGGGAAA
:::.:::::::::.:::.::::::.: ::::::::::::::::::.::::: :::::.:::::.:::::::::: ..::::::::::.:::::::: .::
CAAAGCTTTTGACTTTGCTCCTCCCGTGGCTGTTCCTGAACAGAAGGATCCCGATCCCGAGTTCCCAACAGTGACGCACCCGAATCCTGAAGAGGGTGAA
--K--A--F--D--F--A--P--P--V--A--V--P--E--Q--K--D--P--D--P--E--F--P--T--V--T--H--P--N--P--E--E--G--E-

--------><------------------------------------------------------------------------------------------
-G--V--L--T--L--S--F--A--L--A--D--K--T--K--A--R--I--V--L--A--N--D--P--D--A--D--R--L--A--V--A--E--K--
GGTGTCTTGACTTTGTCTTTTGCTTTGGCTGACAAAACCAAGGCCAGAATTGTTTTAGCTAACGACCCGGATGCTGATAGACTTGCTGTGGCAGAAAAGC
.. :.::::   ::.:::::::::::::::::::.:.:::::::::.:::..::::::: ::::::::.:::::::::::::::::::::::::::::::
AAGGCCTTG---TTATCTTTTGCTTTGGCTGACAGAGCCAAGGCCAAAATCATTTTAGCAAACGACCCAGATGCTGATAGACTTGCTGTGGCAGAAAAGC
-K--A--L-----L--S--F--A--L--A--D--R--A--K--A--K--I--I--L--A--N--D--P--D--A--D--R--L--A--V--A--E--K--

------><--------------------------------------------------------------------------------------------
Q--D--S--G--E--W--R--V--F--S--G--N--E--L--G--A--L--L--G--W--W--L--F--T--S--W--K--E--K--N--Q--D--R--S
AAGACAGTGGTGAATGGAGGGTGTTTTCAGGCAATGAGTTGGGGGCCCTCCTGGGCTGGTGGCTTTTTACATCTTGGAAAGAGAAGAACCAGGATCGCAG
:::::   :: :: ::::..:::::::: :::::::::::::::::::::.:::::::::::::.::::: : :::::::::.::::::::.:::: :::
AAGAC---GGGGATTGGAAAGTGTTTTCCGGCAATGAGTTGGGGGCCCTCTTGGGCTGGTGGCTCTTTACTTGTTGGAAAGAAAAGAACCAAGATCCCAG
Q--D-----G--D--W--K--V--F--S--G--N--E--L--G--A--L--L--G--W--W--L--F--T--C--W--K--E--K--N--Q--D--P--S

---------------------------------------------------------------------------------------><-----------
--A--L--K--D--T--Y--M--L--S--S--T--V--S--S--K--I--L--R--A--I--A--L--K--E--G--F--H--F--E--E--T--L--T-
TGCTCTCAAAGACACGTACATGTTGTCCAGCACCGTCTCCTCCAAAATCTTGCGGGCCATTGCCTTAAAGGAAGGTTTTCATTTTGAGGAAACATTAACT
.::::::::::::::.::::::.::::::::::::: :::::::.::::.:::.::::::::::::::::::.::::::::.::.:::::::: ::.:: 
CGCTCTCAAAGACACATACATGCTGTCCAGCACCGTGTCCTCCAGAATCCTGCAGGCCATTGCCTTAAAGGAGGGTTTTCACTTCGAGGAAACTTTGACA
--A--L--K--D--T--Y--M--L--S--S--T--V--S--S--R--I--L--Q--A--I--A--L--K--E--G--F--H--F--E--E--T--L--T-

---------------------------------------------------------------------------------><-----------------
-G--F--K--W--M--G--N--R--A--K--Q--L--I--D--Q--G--K--T--V--L--F--A--F--E--E--A--I--G--Y--M--C--C--P--
GGCTTTAAGTGGATGGGAAACAGAGCCAAACAGCTAATAGACCAGGGGAAAACTGTTTTATTTGCATTTGAAGAAGCTATTGGATACATGTGCTGCCCTT
:::::.::::::::::::::: :.:::::.::::::::.:: :::::::::: :::.::::::::::::::::::::::::   ::.:::::::::::::
GGCTTCAAGTGGATGGGAAACCGGGCCAAGCAGCTAATGGAGCAGGGGAAAAATGTCTTATTTGCATTTGAAGAAGCTATT---TATATGTGCTGCCCTT
-G--F--K--W--M--G--N--R--A--K--Q--L--M--E--Q--G--K--N--V--L--F--A--F--E--E--A--I-----Y--M--C--C--P--

----------------------------------------------------------------------------------------------------
F--V--L--D--K--D--G--V--S--A--A--V--I--S--A--E--L--A--S--F--L--A--T--K--N--L--S--L--S--Q--Q--L--K--A
TTGTTCTGGACAAAGATGGAGTCAGTGCCGCTGTCATAAGTGCAGAGTTGGCTAGCTTCCTAGCAACCAAGAATTTGTCTTTGTCTCAGCAACTAAAGGC
:.::::::::::::::::::::::::::.::.::::::::.:::::::::::.:::::.::::::::::::::::::::::::::::::::.::::: ::
TCGTTCTGGACAAAGATGGAGTCAGTGCTGCCGTCATAAGCGCAGAGTTGGCCAGCTTTCTAGCAACCAAGAATTTGTCTTTGTCTCAGCAGCTAAATGC
F--V--L--D--K--D--G--V--S--A--A--V--I--S--A--E--L--A--S--F--L--A--T--K--N--L--S--L--S--Q--Q--L--N--A

-----------><---------------------------------------------------------------------------------------
--I--Y--V--E--Y--G--Y--H--I--T--K--A--S--Y--F--I--C--H--D--Q--E--T--I--K--K--L--F--E--N--L--R--N--Y-
CATTTATGTGGAGTATGGCTACCATATTACTAAAGCTTCCTATTTTATCTGCCATGATCAAGAAACCATTAAGAAATTATTTGAAAACCTCAGAAACTAC
:::.:::      ::::::::::::.::::.:::: : : ::::::::::::::::::::::. : ..::::.:::::::::::::::::.:::::::::
CATCTAT------TATGGCTACCATGTTACCAAAGGTACATATTTTATCTGCCATGATCAAGGCAATGTTAAAAAATTATTTGAAAACCTTAGAAACTAC
--I--Y--------Y--G--Y--H--V--T--K--G--T--Y--F--I--C--H--D--Q--G--N--V--K--K--L--F--E--N--L--R--N--Y-

----------------------------------------------------------------------------------------------------
-D--G--K--N--N--Y--P--K--A--C--G--K--F--E--I--S--A--I--R--D--L--T--T--G--Y--D--D--S--Q--P--D--K--K--
GATGGAAAAAATAATTATCCAAAAGCTTGTGGCAAATTTGAAATTTCTGCCATTAGGGACCTTACAACTGGCTATGATGATAGCCAACCTGATAAAAAAG
:::::.::.:::::::::::::::.:::::::::.:::::::::::::: :::::::::.::::::::::::::::::::::::::::::::::::::::
GATGGGAAGAATAATTATCCAAAAACTTGTGGCAGATTTGAAATTTCTGGCATTAGGGATCTTACAACTGGCTATGATGATAGCCAACCTGATAAAAAAG
-D--G--K--N--N--Y--P--K--T--C--G--R--F--E--I--S--G--I--R--D--L--T--T--G--Y--D--D--S--Q--P--D--K--K--

-><-------------------------------------------------------------------------------------------------
A--V--L--P--T--S--K--S--S--Q--M--I--T--F--T--F--A--N--G--G--V--A--T--M--R--T--S--G--T--E--P--K--I--K
CTGTTCTTCCCACTAGTAAAAGCAGCCAAATGATCACCTTCACCTTTGCTAATGGAGGCGTGGCCACCATGCGCACCAGTGGGACAGAGCCCAAAATCAA
::                              :::::::::::.::::::::.:::::::::::::: :: :: :::::::::::.::.:::::::::::
CT------------------------------ATCACCTTCACTTTTGCTAACGGAGGCGTGGCCACGATCCGGACCAGTGGGACGGAACCCAAAATCAA
A--------------------------------I--T--F--T--F--A--N--G--G--V--A--T--I--R--T--S--G--T--E--P--K--I--K

-----------------------------------><---------------------------------------------------------------
--Y--Y--A--E--L--C--A--P--P--G--N--S--D--P--E--Q--L--K--K--E--L--N--E--L--V--S--A--I--E--E--H--F--F-
GTACTATGCAGAGCTGTGTGCCCCACCTGGGAACAGTGATCCTGAGCAGCTGAAGAAGGAACTGAATGAACTGGTCAGTGCTATTGAAGAACATTTTTTC
::::::. :.::.:: ::.:::::.:::::.      ::::::::::::::.:::::.:::::.::::::::. :.:::::::::.:::::::::::.::
GTACTACTCGGAACTCTGCGCCCCGCCTGGA------GATCCTGAGCAGCTAAAGAAAGAACTAAATGAACTATTTAGTGCTATTAAAGAACATTTTCTC
--Y--Y--S--E--L--C--A--P--P--G--------D--P--E--Q--L--K--K--E--L--N--E--L--F--S--A--I--K--E--H--F--L-

-------------------------------------->
-Q--P--Q--K--Y--N--L--Q--P--K--A--D--*-
CAGCCACAGAAGTACAATCTGCAGCCAAAAGCAGACTAA
:::::: :.:::::.::. :: ::::::::: .:. :::
CAGCCAGAAAAGTATAACATGAAGCCAAAAGAGGGGTAA
-Q--P--E--K--Y--N--M--K--P--K--E--G--*-

Pig Consensus Sequence

>BGISUST0000899418
---GCGACTCCGGGAAGCGGCGGCCCCAGCGTGGACGCCCGGCTGGACCAGGAGACGACCCGGTGGCTGCGATGGGACAAGAATCCTTTAACTTGGGAGT
CAGTGAAACGACTACTTGAAGAAGATAATAAAGAAGAACTGCAGAAATGTTTTGGGGCTCGAATGGAGTTCGGGACAGCTGGTCTCCGAGCTATGATGGG
AGCAGGAATCTCTCGTATGAATGACTTGACCATCATCCAGACTACACAGGGACTTTGCAGATACCTGGAAAAACAATTCAGTGACCTCAAGCAAAGAGGT
GTTGTGATCAGCTTTGATGCTCGAGCCCATACAGCAAGTGGAGGCAGCAGCAGA---TTTGCCCGGCTTGCTGCAACCGCGTTTATCAGCCAGGGGATTC
CCGTGTACCTCTTTTCTGATATAACCCCGACCCCCTTTGTGCCCTACACAGTATCACACTTGAAACTTTGTGCTGGAATCATGATAACTGCCTCTCACAA
CCCAAAGCAGGATAATGGTTACAAGGTCTACTGGGATAACGGGGCTCAGATCATCTCTCCTCATGATAAAGGGATTGCCCAGGCTATTGAAGAAAACCTA
GAGCCATGGCCTCAGGCGTGGGAAGATTCTATAATCAATGACAGTCCCCTCCTTCATGACCCAAGTGCTTCCATCAATAAGGACTACTTTGAAGACCTTA
AAAAATACTGTTTTCAC---CATGTGAACAGGGAGACCCAGGTGAAGTTTGTGCACACCTCAGTCCACGGTGTGGCCCACCACTTCGTGCAGTCGGCGTT
CAAAGCTTTTGACTTTGCTCCTCCCGTGGCTGTTCCTGAACAGAAGGATCCCGATCCCGAGTTCCCAACAGTGACGCACCCGAATCCTGAAGAGGGTGAA
AAGGCCTTG---TTATCTTTTGCTTTGGCTGACAGAGCCAAGGCCAAAATCATTTTAGCAAACGACCCAGATGCTGATAGACTTGCTGTGGCAGAAAAGC
AAGAC---GGGGATTGGAAAGTGTTTTCCGGCAATGAGTTGGGGGCCCTCTTGGGCTGGTGGCTCTTTACTTGTTGGAAAGAAAAGAACCAAGATCCCAG
CGCTCTCAAAGACACATACATGCTGTCCAGCACCGTGTCCTCCAGAATCCTGCAGGCCATTGCCTTAAAGGAGGGTTTTCACTTCGAGGAAACTTTGACA
GGCTTCAAGTGGATGGGAAACCGGGCCAAGCAGCTAATGGAGCAGGGGAAAAATGTCTTATTTGCATTTGAAGAAGCTATT---TATATGTGCTGCCCTT
TCGTTCTGGACAAAGATGGAGTCAGTGCTGCCGTCATAAGCGCAGAGTTGGCCAGCTTTCTAGCAACCAAGAATTTGTCTTTGTCTCAGCAGCTAAATGC
CATCTAT------TATGGCTACCATGTTACCAAAGGTACATATTTTATCTGCCATGATCAAGGCAATGTTAAAAAATTATTTGAAAACCTTAGAAACTAC
GATGGGAAGAATAATTATCCAAAAACTTGTGGCAGATTTGAAATTTCTGGCATTAGGGATCTTACAACTGGCTATGATGATAGCCAACCTGATAAAAAAG
CT------------------------------ATCACCTTCACTTTTGCTAACGGAGGCGTGGCCACGATCCGGACCAGTGGGACGGAACCCAAAATCAA
GTACTACTCGGAACTCTGCGCCCCGCCTGGA------GATCCTGAGCAGCTAAAGAAAGAACTAAATGAACTATTTAGTGCTATTAAAGAACATTTTCTC
CAGCCAGAAAAGTATAACATGAAGCCAAAAGAGGGGTAA


>BGISUSP0000899418
-ATPGSGGPSVDARLDQETTRWLRWDKNPLTWESVKRLLEEDNKEELQKCFGARMEFGTAGLRAMMGAGISRMNDLTIIQTTQGLCRYLEKQFSDLKQRG
VVISFDARAHTASGGSSR-FARLAATAFISQGIPVYLFSDITPTPFVPYTVSHLKLCAGIMITASHNPKQDNGYKVYWDNGAQIISPHDKGIAQAIEENL
EPWPQAWEDSIINDSPLLHDPSASINKDYFEDLKKYCFH-HVNRETQVKFVHTSVHGVAHHFVQSAFKAFDFAPPVAVPEQKDPDPEFPTVTHPNPEEGE
KAL-LSFALADRAKAKIILANDPDADRLAVAEKQD-GDWKVFSGNELGALLGWWLFTCWKEKNQDPSALKDTYMLSSTVSSRILQAIALKEGFHFEETLT
GFKWMGNRAKQLMEQGKNVLFAFEEAI-YMCCPFVLDKDGVSAAVISAELASFLATKNLSLSQQLNAIY--YGYHVTKGTYFICHDQGNVKKLFENLRNY
DGKNNYPKTCGRFEISGIRDLTTGYDDSQPDKKA----------ITFTFANGGVATIRTSGTEPKIKYYSELCAPPG--DPEQLKKELNELFSAIKEHFL
QPEKYNMKPKEG*